Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
>UniRef90_B3Y8Z0 Major capsid protein (Fragment) n=2 Tax=Myoviridae environmental samples TaxID=336724 RepID=B3Y8Z0_9CAUD NSPVALIFAMKSRYTNQAGAEALFNEANTAFSGTGSHSSPLDPLDPALSVGRPLSAAVGE QMGGAGQPVIPEMAFSIDRISVTAKTRILKAEFTVELQQDLKAIHGLDAEAELANILST

Members

Expand cluster to 50% identity.
List component clusters with 100% identity.
1 to 2 of 2  Show
Cluster membersEntry nameProtein names
Organisms
Organism IDsRelated clustersLength
Role
B3Y8Z0B3Y8Z0_9CAUDMajor capsid protein (Fragment)Myoviridae environmental samples336724UniRef100_B3Y8Z0
119Representative & Seed
A9CXM2A9CXM2_9CAUDMajor capsid protein (Fragment)Myoviridae environmental samples336724UniRef100_B3Y8Z0
118

Sequence

Representative sequenceiLengthMass (Da)Tools
B3Y8Z0

Checksumi: 615AE630C5B8B49D

FASTA11912,425
        10         20         30         40         50
NSPVALIFAM KSRYTNQAGA EALFNEANTA FSGTGSHSSP LDPLDPALSV
60 70 80 90 100
GRPLSAAVGE QMGGAGQPVI PEMAFSIDRI SVTAKTRILK AEFTVELQQD
110
LKAIHGLDAE AELANILST
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again