Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
>UniRef90_B5X3Z6 Lissencephaly-1 homolog A n=24 Tax=Gnathostomata TaxID=7776 RepID=LIS1A_SALSA MVLSQRQRDELNRAIADYLRSNGYEEAYSTFKKEAELDMNEELDKKYAGLLEKKWTSVIR LQKKVMELESKLNEAKEEITLGGPIAQKRDPKEWIPRPPEKYALSGHRSPVTRVIFHPVF SVMVSASEDATIKVWDYETGDFERTLKGHTDSVQDISFDHTGKLLASCSADMTIKLWDFQ GFECIRTMHGHDHNVSSVAIMPNGDHIVSASRDKTIKMWEVATGYCVKTFTGHREWVRMV RPNQDGTLIASCSNDQTVRVWVVASKECKAELREHEHVVECISWAPESAHPTILEATGSE SKKSGKPGPFLLSGSRDKTIKMWDVSIGMCLMTLVGHDNWVRGMLVHPGGKFILSCADDK TLRIWDYKNKRCMKTLGAHEHFVTSLDFHKNAPYVVTGSVDQTVKVWECR

Members

Expand cluster to 50% identity.
List component clusters with 100% identity.
1 to 24 of 24  Show
Cluster membersEntry nameProtein names
Organisms
Organism IDsRelated clustersLength
Role
B5X3Z6LIS1A_SALSALissencephaly-1 homolog ASalmo salar (Atlantic salmon)8030UniRef100_B5X3Z6
410Representative
A0A1S3SZD2A0A1S3SZD2_SALSALissencephaly-1 homologSalmo salar (Atlantic salmon)8030UniRef100_B5X3Z6
410
A0A315VAU9A0A315VAU9_GAMAFLissencephaly-1 homologGambusia affinis (Western mosquitofish) (Heterandria affinis)33528UniRef100_A0A315VAU9
491Seed
A0A3P9QFG1A0A3P9QFG1_POERELissencephaly-1 homologPoecilia reticulata (Guppy) (Acanthophacelus reticulatus)8081UniRef100_A0A3P9QFG1
418
A0A087YAS5A0A087YAS5_POEFOLissencephaly-1 homologPoecilia formosa (Amazon molly) (Limia formosa)48698UniRef100_A0A087YAS5
410
A0A3B3TJX6A0A3B3TJX6_9TELELissencephaly-1 homologPoecilia latipinna (sailfin molly)48699UniRef100_A0A087YAS5
410
A0A3B3YQ35A0A3B3YQ35_9TELELissencephaly-1 homologPoecilia mexicana48701UniRef100_A0A087YAS5
410
A0A1A8RBB3A0A1A8RBB3_9TELELissencephaly-1 homologNothobranchius pienaari704102UniRef100_A0A1A8RBB3
410
A0A1A8IRE2A0A1A8IRE2_NOTKULissencephaly-1 homologNothobranchius kuhntae (Beira killifish)321403UniRef100_A0A1A8RBB3
410
A0A1A8R1M6A0A1A8R1M6_9TELELissencephaly-1 homologNothobranchius rachovii (bluefin notho)451742UniRef100_A0A1A8RBB3
410
A0A1A7ZXF4A0A1A7ZXF4_NOTFULissencephaly-1 homologNothobranchius furzeri (Turquoise killifish)105023UniRef100_A0A1A7ZXF4
410
A0A1A8BV62A0A1A8BV62_9TELELissencephaly-1 homologNothobranchius kadleci1051664UniRef100_A0A1A7ZXF4
410
A0A1A8GR77A0A1A8GR77_9TELELissencephaly-1 homologNothobranchius korthausae1143690UniRef100_A0A1A8GR77
410
A0A3B5QP08A0A3B5QP08_XIPMALissencephaly-1 homologXiphophorus maculatus (Southern platyfish) (Platypoecilus maculatus)8083UniRef100_A0A3B5QP08
410
A0A0S7LER7A0A0S7LER7_9TELELissencephaly-1 homologPoeciliopsis prolifica (blackstripe livebearer)188132UniRef100_A0A3B5QP08
410
A0A1A8FAV5A0A1A8FAV5_9TELELissencephaly-1 homologNothobranchius korthausae1143690UniRef100_A0A1A8FAV5
410
A0A5C6PCX5A0A5C6PCX5_9TELELissencephaly-1 homologTakifugu flavidus (sansaifugu)433684UniRef100_A0A5C6PCX5
410
A0A3B3TKV9A0A3B3TKV9_9TELELissencephaly-1 homologPoecilia latipinna (sailfin molly)48699UniRef100_A0A3B3TKV9
409
A0A3Q3AXM1A0A3Q3AXM1_KRYMALissencephaly-1 homologKryptolebias marmoratus (Mangrove killifish) (Rivulus marmoratus)37003UniRef100_A0A3Q3AXM1
405
A0A3B3XC01A0A3B3XC01_9TELELissencephaly-1 homologPoecilia mexicana48701UniRef100_A0A3B3XC01
400
A0A4Z2CCE4A0A4Z2CCE4_9TELELissencephaly-1 homologTakifugu bimaculatus433685UniRef100_A0A4Z2CCE4
393
UPI0009A461A0platelet-activating factor acetylhydrolase IB subunit alphaRhincodon typus (whale shark)259920UniRef100_UPI0009A461A0
414
UPI0010F6389Eplatelet-activating factor acetylhydrolase IB subunit alphaBetta splendens (Siamese fighting fish)158456UniRef100_UPI0010F6389E
410
UPI0003F0D23Eplatelet-activating factor acetylhydrolase IB subunit alphaElephantulus edwardii (Cape long-eared elephant shrew)28737UniRef100_UPI0003F0D23E
404

Sequence

Representative sequenceiLengthMass (Da)Tools
B5X3Z6

Checksumi: 360D54FC610B1EE7

FASTA41046,591
        10         20         30         40         50
MVLSQRQRDE LNRAIADYLR SNGYEEAYST FKKEAELDMN EELDKKYAGL
60 70 80 90 100
LEKKWTSVIR LQKKVMELES KLNEAKEEIT LGGPIAQKRD PKEWIPRPPE
110 120 130 140 150
KYALSGHRSP VTRVIFHPVF SVMVSASEDA TIKVWDYETG DFERTLKGHT
160 170 180 190 200
DSVQDISFDH TGKLLASCSA DMTIKLWDFQ GFECIRTMHG HDHNVSSVAI
210 220 230 240 250
MPNGDHIVSA SRDKTIKMWE VATGYCVKTF TGHREWVRMV RPNQDGTLIA
260 270 280 290 300
SCSNDQTVRV WVVASKECKA ELREHEHVVE CISWAPESAH PTILEATGSE
310 320 330 340 350
SKKSGKPGPF LLSGSRDKTI KMWDVSIGMC LMTLVGHDNW VRGMLVHPGG
360 370 380 390 400
KFILSCADDK TLRIWDYKNK RCMKTLGAHE HFVTSLDFHK NAPYVVTGSV
410
DQTVKVWECR
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again