Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
>UniRef90_B7LRS1 50S ribosomal protein L6 n=762 RepID=RL6_ESCF3 MSRVAKAPVVVPAGVDVKINGQVITIKGKNGELTRTLNDAVEVKHADNTLTFGPRDGYAD GWAQAGTARALLNSMVIGVTEGFTKKLQLVGVGYRAAVKGNVVNLSLGFSHPVDHQLPAG ITAECPTQTEIVLKGADKQVIGQVAADLRAYRRPEPYKGKGVRYADEVVRTKEAKKK

Members

Expand cluster to 50% identity.
List component clusters with 100% identity.
1 to 25 of 762  Show
Cluster membersEntry nameProtein names
Organisms
Organism IDsRelated clustersLength
Role
B7LRS1RL6_ESCF350S ribosomal protein L6Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73)585054UniRef100_B7LRS1
177Representative
B5FJJ9RL6_SALDC50S ribosomal protein L6Salmonella dublin (strain CT_02021853)439851UniRef100_B5FJJ9
177
A7ZSJ4RL6_ECO2450S ribosomal protein L6Escherichia coli O139:H28 (strain E24377A / ETEC)331111UniRef100_A7ZSJ4
177
B7UK29RL6_ECO2750S ribosomal protein L6Escherichia coli O127:H6 (strain E2348/69 / EPEC)574521UniRef100_A7ZSJ4
177
B7MCS0RL6_ECO4550S ribosomal protein L6Escherichia coli O45:K1 (strain S88 / ExPEC)585035UniRef100_A7ZSJ4
177
B7LI04RL6_ECO5550S ribosomal protein L6Escherichia coli (strain 55989 / EAEC)585055UniRef100_A7ZSJ4
177
P0AG57RL6_ECO5750S ribosomal protein L6Escherichia coli O157:H783334UniRef100_A7ZSJ4
177
B5YTM6RL6_ECO5E50S ribosomal protein L6Escherichia coli O157:H7 (strain EC4115 / EHEC)444450UniRef100_A7ZSJ4
177
B7NLM4RL6_ECO7I50S ribosomal protein L6Escherichia coli O7:K1 (strain IAI39 / ExPEC)585057UniRef100_A7ZSJ4
177
B7N189RL6_ECO8150S ribosomal protein L6Escherichia coli O81 (strain ED1a)585397UniRef100_A7ZSJ4
177
B7M1L9RL6_ECO8A50S ribosomal protein L6Escherichia coli O8 (strain IAI1)585034UniRef100_A7ZSJ4
177
C4ZUG0RL6_ECOBW50S ribosomal protein L6Escherichia coli (strain K12 / MC4100 / BW2952)595496UniRef100_A7ZSJ4
177
B1X6F7RL6_ECODH50S ribosomal protein L6Escherichia coli (strain K12 / DH10B)316385UniRef100_A7ZSJ4
177
A8A5B0RL6_ECOHS50S ribosomal protein L6Escherichia coli O9:H4 (strain HS)331112UniRef100_A7ZSJ4
177
A1AGJ4RL6_ECOK150S ribosomal protein L6Escherichia coli O1:K1 / APEC405955UniRef100_A7ZSJ4
177
Q0TCF6RL6_ECOL550S ribosomal protein L6Escherichia coli O6:K15:H31 (strain 536 / UPEC)362663UniRef100_A7ZSJ4
177
P0AG56RL6_ECOL650S ribosomal protein L6Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)199310UniRef100_A7ZSJ4
177
B1IPZ4RL6_ECOLC50S ribosomal protein L6Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks)481805UniRef100_A7ZSJ4
177
P0AG55RL6_ECOLI50S ribosomal protein L6Escherichia coli (strain K12)83333UniRef100_A7ZSJ4
177
B7NDS6RL6_ECOLU50S ribosomal protein L6Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)585056UniRef100_A7ZSJ4
177
B6I219RL6_ECOSE50S ribosomal protein L6Escherichia coli (strain SE11)409438UniRef100_A7ZSJ4
177
B1LHB9RL6_ECOSM50S ribosomal protein L6Escherichia coli (strain SMS-3-5 / SECEC)439855UniRef100_A7ZSJ4
177
Q1R624RL6_ECOUT50S ribosomal protein L6Escherichia coli (strain UTI89 / UPEC)364106UniRef100_A7ZSJ4
177
B2U2S3RL6_SHIB350S ribosomal protein L6Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)344609UniRef100_A7ZSJ4
177
Q31VX1RL6_SHIBS50S ribosomal protein L6Shigella boydii serotype 4 (strain Sb227)300268UniRef100_A7ZSJ4
177

Sequence

Representative sequenceiLengthMass (Da)Tools
B7LRS1

Checksumi: 946B7C52595A45C2

FASTA17718,890
        10         20         30         40         50
MSRVAKAPVV VPAGVDVKIN GQVITIKGKN GELTRTLNDA VEVKHADNTL
60 70 80 90 100
TFGPRDGYAD GWAQAGTARA LLNSMVIGVT EGFTKKLQLV GVGYRAAVKG
110 120 130 140 150
NVVNLSLGFS HPVDHQLPAG ITAECPTQTE IVLKGADKQV IGQVAADLRA
160 170
YRRPEPYKGK GVRYADEVVR TKEAKKK
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again