Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
>UniRef90_B9M6H3 50S ribosomal protein L22 n=3 Tax=Geobacter TaxID=28231 RepID=RL22_GEODF MESTAKLSFARLSPRKTRLVVDMVRGKGIQNALNTLRFSPQPSAKLVSKLLSSAVANAEQ KGVADVDRLYVKTIYVDGGTVLKRFVPRAMGRASKIRKPTSHICVVLAEKK

Members

Expand cluster to 50% identity.
List component clusters with 100% identity.
1 to 3 of 3  Show
Cluster membersEntry nameProtein names
Organisms
Organism IDsRelated clustersLength
Role
B9M6H3RL22_GEODF50S ribosomal protein L22Geobacter daltonii (strain DSM 22248 / JCM 15807 / FRC-32)316067UniRef100_B9M6H3
111Representative & Seed
A5GAX0RL22_GEOUR50S ribosomal protein L22Geobacter uraniireducens (strain Rf4) (Geobacter uraniumreducens)351605UniRef100_A5GAX0
111
A0A212PHV8A0A212PHV8_9DELT50S ribosomal protein L22Geobacter sp. DSM 97361277350UniRef100_A0A212PHV8
110

Sequence

Representative sequenceiLengthMass (Da)Tools
B9M6H3

Checksumi: 761930462C0501EE

FASTA11112,167
        10         20         30         40         50
MESTAKLSFA RLSPRKTRLV VDMVRGKGIQ NALNTLRFSP QPSAKLVSKL
60 70 80 90 100
LSSAVANAEQ KGVADVDRLY VKTIYVDGGT VLKRFVPRAM GRASKIRKPT
110
SHICVVLAEK K
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again