Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
>UniRef90_F1K3M0 Envelope glycoprotein gp160 n=145 Tax=Human immunodeficiency virus 1 TaxID=11676 RepID=F1K3M0_9HIV1 MKARETRKNYQSLWKWQSLWKWGTMLLGMLMICSATEQLWVTVYYGVPVWKEATTTLFCA SDAKAYDTEAHNVWATHACVPTDPNPQEVVLGNVTEYFNAWKNDMVEQMHEDIISLWDQS LKPCVKLTPLCVTLNCTDLKNTTSTNATRPNTSPNNTMEEGDMKNCSFNVTTSIRNKLQK EYALFYKLDIVPIDGDNESYALISCNTSVITQACPKVSFEPIPIHYCAPAGFAILKCNEE NFNGTGPCTNVSTVQCTHGIKPVVSTQLLLNGSLAEKEVVIRSENITDNAKTIMVHLNKS VIINCTRYNNNTRRSINIGPGRAFYATGDIIGDIRKSHCNVSKADWMRTLKDVAQKLREK FGNDTKIAFNKTSGGDPEIVMHSFNCGGEFFYCNTTELFNDTWLSNNTWLSNYTESNNNT AKNIVLPCRIKQIINRWQEVGKAMYAPPISGLIRCSSNITGLLLTRDGGNHNTSNDTETF RPGGGDMRDNWRSELYKYKVVKIEPLGVAPTKARRRVVQREKRAVGLGALFLGFLGAAGS TMGAASVTLTVQARQLLSGIVQQQNNLLRAIEAQQHMLQLTVWGIKQLQARVLAVERYLK DQQLLGIWGCSGKLICTTNVPWNVTWSNKSLDNIWNNMTWMEWEREIDNYTSLIYSLIEE SQNQQEKNEQELLALDKWASLWNWFNISNWLWYIKIFIMIVGGLIGLRIVFTVLSIVNRV RQGYSPLSFQTLLPTQRGPDRPGGIEEEGGERDRDTSGQLVHGFLAIIWVDLRNLFLFLY HRLRDLLLIATRIVELLGRRGWEILKYLWNLLLYWSQELKNSAVSLLNATAIAVAEGTDR IIEILQRFCRGILHIPTRIRQGFERALL

Members

Expand cluster to 50% identity.
List component clusters with 100% identity.
1 to 25 of 145  Show
Cluster membersEntry nameProtein names
Organisms
Organism IDsRelated clustersLength
Role
F1K3M0F1K3M0_9HIV1Envelope glycoprotein gp160Human immunodeficiency virus 111676UniRef100_F1K3M0
868Representative
A0A346IAA9A0A346IAA9_9HIV1Envelope glycoprotein gp160Human immunodeficiency virus 111676UniRef100_A0A346IAA9
876Seed
A0A346IAI0A0A346IAI0_9HIV1Envelope glycoprotein gp160Human immunodeficiency virus 111676UniRef100_A0A346IAI0
872
A0A346IAE8A0A346IAE8_9HIV1Envelope glycoprotein gp160Human immunodeficiency virus 111676UniRef100_A0A346IAE8
872
A0A346IA85A0A346IA85_9HIV1Envelope glycoprotein gp160Human immunodeficiency virus 111676UniRef100_A0A346IA85
871
A0A346IAI8A0A346IAI8_9HIV1Envelope glycoprotein gp160Human immunodeficiency virus 111676UniRef100_A0A346IAI8
871
O36224O36224_9HIV1Envelope glycoprotein (Fragment)Human immunodeficiency virus 111676UniRef100_A0A346IAI8
27
A0A346IAT0A0A346IAT0_9HIV1Envelope glycoprotein gp160Human immunodeficiency virus 111676UniRef100_A0A346IAT0
871
A0A346IA65A0A346IA65_9HIV1Envelope glycoprotein gp160Human immunodeficiency virus 111676UniRef100_A0A346IA65
869
A0A346IA93A0A346IA93_9HIV1Envelope glycoprotein gp160Human immunodeficiency virus 111676UniRef100_A0A346IA93
869
A0A346IAR8A0A346IAR8_9HIV1Envelope glycoprotein gp160Human immunodeficiency virus 111676UniRef100_A0A346IAR8
869
A0A346IAR0A0A346IAR0_9HIV1Envelope glycoprotein gp160Human immunodeficiency virus 111676UniRef100_A0A346IAR0
869
A0A346IAN6A0A346IAN6_9HIV1Envelope glycoprotein gp160Human immunodeficiency virus 111676UniRef100_A0A346IAN6
869
A0A1I9WF15A0A1I9WF15_9HIV1Envelope glycoprotein gp160Human immunodeficiency virus 111676UniRef100_A0A1I9WF15
868
A0A1I9WFF3A0A1I9WFF3_9HIV1Envelope glycoprotein gp160Human immunodeficiency virus 111676UniRef100_A0A1I9WFF3
868
A0A346IDB8A0A346IDB8_9HIV1Envelope glycoprotein gp160Human immunodeficiency virus 111676UniRef100_A0A346IDB8
868
A0A1I9WFF7A0A1I9WFF7_9HIV1Envelope glycoprotein gp160Human immunodeficiency virus 111676UniRef100_A0A1I9WFF7
868
A0A1I9WF81A0A1I9WF81_9HIV1Envelope glycoprotein gp160Human immunodeficiency virus 111676UniRef100_A0A1I9WF81
868
A0A346ID66A0A346ID66_9HIV1Envelope glycoprotein gp160Human immunodeficiency virus 111676UniRef100_A0A346ID66
868
A0A346ID26A0A346ID26_9HIV1Envelope glycoprotein gp160Human immunodeficiency virus 111676UniRef100_A0A346ID26
868
A0A346ID14A0A346ID14_9HIV1Envelope glycoprotein gp160Human immunodeficiency virus 111676UniRef100_A0A346ID14
868
A0A346ID82A0A346ID82_9HIV1Envelope glycoprotein gp160Human immunodeficiency virus 111676UniRef100_A0A346ID82
868
A0A1I9WF27A0A1I9WF27_9HIV1Envelope glycoprotein gp160Human immunodeficiency virus 111676UniRef100_A0A1I9WF27
868
A0A1I9WF77A0A1I9WF77_9HIV1Envelope glycoprotein gp160Human immunodeficiency virus 111676UniRef100_A0A1I9WF77
868
A0A1I9WF71A0A1I9WF71_9HIV1Envelope glycoprotein gp160Human immunodeficiency virus 111676UniRef100_A0A1I9WF71
868

Sequence

Representative sequenceiLengthMass (Da)Tools
F1K3M0

Checksumi: D7D549121D565641

FASTA86898,552
        10         20         30         40         50
MKARETRKNY QSLWKWQSLW KWGTMLLGML MICSATEQLW VTVYYGVPVW
60 70 80 90 100
KEATTTLFCA SDAKAYDTEA HNVWATHACV PTDPNPQEVV LGNVTEYFNA
110 120 130 140 150
WKNDMVEQMH EDIISLWDQS LKPCVKLTPL CVTLNCTDLK NTTSTNATRP
160 170 180 190 200
NTSPNNTMEE GDMKNCSFNV TTSIRNKLQK EYALFYKLDI VPIDGDNESY
210 220 230 240 250
ALISCNTSVI TQACPKVSFE PIPIHYCAPA GFAILKCNEE NFNGTGPCTN
260 270 280 290 300
VSTVQCTHGI KPVVSTQLLL NGSLAEKEVV IRSENITDNA KTIMVHLNKS
310 320 330 340 350
VIINCTRYNN NTRRSINIGP GRAFYATGDI IGDIRKSHCN VSKADWMRTL
360 370 380 390 400
KDVAQKLREK FGNDTKIAFN KTSGGDPEIV MHSFNCGGEF FYCNTTELFN
410 420 430 440 450
DTWLSNNTWL SNYTESNNNT AKNIVLPCRI KQIINRWQEV GKAMYAPPIS
460 470 480 490 500
GLIRCSSNIT GLLLTRDGGN HNTSNDTETF RPGGGDMRDN WRSELYKYKV
510 520 530 540 550
VKIEPLGVAP TKARRRVVQR EKRAVGLGAL FLGFLGAAGS TMGAASVTLT
560 570 580 590 600
VQARQLLSGI VQQQNNLLRA IEAQQHMLQL TVWGIKQLQA RVLAVERYLK
610 620 630 640 650
DQQLLGIWGC SGKLICTTNV PWNVTWSNKS LDNIWNNMTW MEWEREIDNY
660 670 680 690 700
TSLIYSLIEE SQNQQEKNEQ ELLALDKWAS LWNWFNISNW LWYIKIFIMI
710 720 730 740 750
VGGLIGLRIV FTVLSIVNRV RQGYSPLSFQ TLLPTQRGPD RPGGIEEEGG
760 770 780 790 800
ERDRDTSGQL VHGFLAIIWV DLRNLFLFLY HRLRDLLLIA TRIVELLGRR
810 820 830 840 850
GWEILKYLWN LLLYWSQELK NSAVSLLNAT AIAVAEGTDR IIEILQRFCR
860
GILHIPTRIR QGFERALL
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again