Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
>UniRef90_F1NJU6 SMAD specific E3 ubiquitin protein ligase 2 n=27 Tax=Archosauria TaxID=8492 RepID=F1NJU6_CHICK FYISCFSTVLCAKNLVKKDFFRLPDPFAKVVVDGSGQCHSTDTVKNTLDPKWNQHYDLYI GKSDSITISVWNHKKIHKKQGAGFLGCVRLLSNAINRLKDTGYQRLDLCKLGPNDNDTVR GQIVVSLQSRDRIGTGGQVVDCSRLFDNDLPDGWEERRTASGRIQYLNHITRTTQWERPT RPASEYSSPGRPLSCFVDENTPITGTNGATCGQSSDPRLAERRVTGKMGCVYFLHTQTGV STWHDPRVPRDLSNINCEELGPLPPGWEIRNTATGRVYFVDHNNRTTQFTDPRLSANLHL VLNRQNQLKDQQHQQQQQVVSLCQLPDEAECLTVPRYKRDLVQKLKILRQELSQQQPQAG HCRIEVSREEIFEESYRQVMKMRPKDLWKRLMIKFRGEEGLDYGGVAREWLYLLSHEMLN PYYGLFQYSRDDIYTLQINPDSAVNPEHLSYFHFVGRIMGMAVFHGHYIDGGFTLPFYKQ LLGKPITLDDMELVDPDLHNSLVWILENDITGVLDHTFCVEHNAYGEIIQHELKPNGKSI PVTEENKKEYVRLYVNWRFLRGIEAQFLALQKGFNEVIPQHLLKTFDEKELELIICGLGK IDVNDWKANTRLKHCTPDSNIVKWFWKAVEFFDEERRARLLQFVTGSSRVPLQGFKALQG AAGPRLFTIHQIDASTNNLPKAHTCFNRIDIPPYESYDKLYEKLLTAIEETCGFAVE

Members

Expand cluster to 50% identity.
List component clusters with 100% identity.
1 to 25 of 27  Show
Cluster membersEntry nameProtein names
Organisms
Organism IDsRelated clustersLength
Role
F1NJU6F1NJU6_CHICKSMAD specific E3 ubiquitin protein ligase 2Gallus gallus (Chicken)9031UniRef100_F1NJU6
717Representative
A0A226NB55A0A226NB55_CALSUE3 ubiquitin-protein ligaseCallipepla squamata (Scaled quail)9009UniRef100_A0A226NB55
863Seed
A0A1U7RCF2A0A1U7RCF2_ALLSIE3 ubiquitin-protein ligaseAlligator sinensis (Chinese alligator)38654UniRef100_A0A1U7RCF2
748
A0A226P699A0A226P699_COLVIE3 ubiquitin-protein ligaseColinus virginianus (Northern bobwhite) (Tetrao virginianus)9014UniRef100_A0A226P699
744
A0A091HZU0A0A091HZU0_CALANE3 ubiquitin-protein ligase SMURF2 (Fragment)Calypte anna (Anna's hummingbird) (Archilochus anna)9244UniRef100_A0A091HZU0
742
A0A093J1N8A0A093J1N8_EURHLE3 ubiquitin-protein ligase SMURF2 (Fragment)Eurypyga helias (Sunbittern)54383UniRef100_A0A093J1N8
738
A0A091G8Y0A0A091G8Y0_9AVESE3 ubiquitin-protein ligase SMURF2 (Fragment)Cuculus canorus (common cuckoo)55661UniRef100_A0A091G8Y0
738
A0A3M0J4P5A0A3M0J4P5_HIRRUUncharacterized proteinHirundo rustica rustica333673UniRef100_A0A3M0J4P5
725
A0A0Q3Q0Y3A0A0Q3Q0Y3_AMAAEE3 ubiquitin-protein ligaseAmazona aestiva (Blue-fronted Amazon parrot)12930UniRef100_A0A0Q3Q0Y3
725
A0A093L4G8A0A093L4G8_FULGAE3 ubiquitin-protein ligase SMURF2 (Fragment)Fulmarus glacialis (Northern fulmar)30455UniRef100_A0A093L4G8
686
UPI0007772E50E3 ubiquitin-protein ligase SMURF2 isoform X2Coturnix japonica (Japanese quail) (Coturnix coturnix japonica)93934UniRef100_UPI0007772E50
749
UPI0005286F8CE3 ubiquitin-protein ligase SMURF2Eurypyga helias (Sunbittern)54383UniRef100_A0A1U7RCF2
736
UPI000E1B687CE3 ubiquitin-protein ligase SMURF2 isoform X2Nothoprocta perdicaria (Chilean tinamou) (Crypturus perdicarius)30464UniRef100_UPI000E1B687C
747
UPI0005224239E3 ubiquitin-protein ligase SMURF2Haliaeetus albicilla (White-tailed sea-eagle)8969UniRef100_UPI0005224239
745
UPI0007778F58E3 ubiquitin-protein ligase SMURF2 isoform X3Coturnix japonica (Japanese quail) (Coturnix coturnix japonica)93934UniRef100_UPI0007778F58
743
UPI000EF71448E3 ubiquitin-protein ligase SMURF2 isoform X1Athene cunicularia (Burrowing owl) (Speotyto cunicularia)194338UniRef100_UPI000EF71448
742
UPI000B3D8C6AE3 ubiquitin-protein ligase SMURF2 isoform X2Numida meleagris (Helmeted guineafowl) (Phasianus meleagris)8996UniRef100_UPI000B3D8C6A
741
UPI000939AA9BE3 ubiquitin-protein ligase SMURF2 isoform X2Meleagris gallopavo (Wild turkey)9103UniRef100_UPI000939AA9B
741
UPI000386FCA5E3 ubiquitin-protein ligase SMURF2Cariama cristata (Red-legged seriema)54380UniRef100_UPI000386FCA5
740
UPI000523DF54E3 ubiquitin-protein ligase SMURF2Tauraco erythrolophus (Red-crested turaco)121530UniRef100_UPI000523DF54
740
UPI00052393E6E3 ubiquitin-protein ligase SMURF2Chaetura pelagica (Chimney swift)8897UniRef100_UPI00052393E6
740
UPI0004F04600E3 ubiquitin-protein ligase SMURF2Merops nubicus (Northern carmine bee-eater)57421UniRef100_UPI0004F04600
740
UPI00051BCA4FE3 ubiquitin-protein ligase SMURF2Cuculus canorus (common cuckoo)55661UniRef100_UPI00051BCA4F
740
UPI00052394CFE3 ubiquitin-protein ligase SMURF2Tyto alba (Barn owl)56313UniRef100_UPI00052394CF
740
UPI000549D41DE3 ubiquitin-protein ligase SMURF2 isoform X3Meleagris gallopavo (Wild turkey)9103UniRef100_UPI000549D41D
738

Sequence

Representative sequenceiLengthMass (Da)Tools
F1NJU6

Checksumi: E294A265FE567D58

FASTA71782,485
        10         20         30         40         50
FYISCFSTVL CAKNLVKKDF FRLPDPFAKV VVDGSGQCHS TDTVKNTLDP
60 70 80 90 100
KWNQHYDLYI GKSDSITISV WNHKKIHKKQ GAGFLGCVRL LSNAINRLKD
110 120 130 140 150
TGYQRLDLCK LGPNDNDTVR GQIVVSLQSR DRIGTGGQVV DCSRLFDNDL
160 170 180 190 200
PDGWEERRTA SGRIQYLNHI TRTTQWERPT RPASEYSSPG RPLSCFVDEN
210 220 230 240 250
TPITGTNGAT CGQSSDPRLA ERRVTGKMGC VYFLHTQTGV STWHDPRVPR
260 270 280 290 300
DLSNINCEEL GPLPPGWEIR NTATGRVYFV DHNNRTTQFT DPRLSANLHL
310 320 330 340 350
VLNRQNQLKD QQHQQQQQVV SLCQLPDEAE CLTVPRYKRD LVQKLKILRQ
360 370 380 390 400
ELSQQQPQAG HCRIEVSREE IFEESYRQVM KMRPKDLWKR LMIKFRGEEG
410 420 430 440 450
LDYGGVAREW LYLLSHEMLN PYYGLFQYSR DDIYTLQINP DSAVNPEHLS
460 470 480 490 500
YFHFVGRIMG MAVFHGHYID GGFTLPFYKQ LLGKPITLDD MELVDPDLHN
510 520 530 540 550
SLVWILENDI TGVLDHTFCV EHNAYGEIIQ HELKPNGKSI PVTEENKKEY
560 570 580 590 600
VRLYVNWRFL RGIEAQFLAL QKGFNEVIPQ HLLKTFDEKE LELIICGLGK
610 620 630 640 650
IDVNDWKANT RLKHCTPDSN IVKWFWKAVE FFDEERRARL LQFVTGSSRV
660 670 680 690 700
PLQGFKALQG AAGPRLFTIH QIDASTNNLP KAHTCFNRID IPPYESYDKL
710
YEKLLTAIEE TCGFAVE
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again