Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
>UniRef90_F6RHZ4 FERM domain-containing protein n=23 Tax=Theria TaxID=32525 RepID=F6RHZ4_MACMU MAGAIASRMSFSSLKRKQPKTFTVRIVTMDAEMEFNCEMKWKGKDLFDLVCRTLGLRETW FFGLQYTIKDTVAWLKMDKKVLDHDVSKEEPVTFHFLAKFYPENAEEELVQEITQHLFFL QVKKQILDEKIYCPPEASVLLASYAVQAKLTLQSTKSRVAFFEEL

Members

Expand cluster to 50% identity.
List component clusters with 100% identity.
1 to 23 of 23  Show
Cluster membersEntry nameProtein names
Organisms
Organism IDsRelated clustersLength
Role
F6RHZ4F6RHZ4_MACMUFERM domain-containing proteinMacaca mulatta (Rhesus macaque)9544UniRef100_F6RHZ4
165Representative
A0A2K5WC42A0A2K5WC42_MACFAFERM domain-containing proteinMacaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)9541UniRef100_F6RHZ4
165
A0A4X2KWV8A0A4X2KWV8_VOMURFERM domain-containing proteinVombatus ursinus (Common wombat)29139UniRef100_F6RHZ4
165
A0A3Q7SIY0A0A3Q7SIY0_VULVUmerlin isoform X3Vulpes vulpes (Red fox)9627UniRef100_A0A3Q7SIY0
179Seed
A0A2I3R9Z1A0A2I3R9Z1_PANTRNF2 isoform 1Pan troglodytes (Chimpanzee)9598UniRef100_A0A2I3R9Z1
165
A0A4W2F952A0A4W2F952_BOBOXFERM domain-containing proteinBos indicus x Bos taurus (Hybrid cattle)30522UniRef100_A0A2I3R9Z1
165
A0A2K6NI97A0A2K6NI97_RHIROFERM domain-containing proteinRhinopithecus roxellana (Golden snub-nosed monkey) (Pygathrix roxellana)61622UniRef100_A0A2I3R9Z1
165
F6UTG8F6UTG8_CALJAFERM domain-containing proteinCallithrix jacchus (White-tufted-ear marmoset)9483UniRef100_A0A2I3R9Z1
165
A0A2J8UUW7A0A2J8UUW7_PONABNF2 isoform 1Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii)9601UniRef100_A0A2I3R9Z1
165
A0A2K5P523A0A2K5P523_CERATFERM domain-containing proteinCercocebus atys (Sooty mangabey) (Cercocebus torquatus atys)9531UniRef100_A0A2I3R9Z1
165
A0A337SA12A0A337SA12_FELCAFERM domain-containing proteinFelis catus (Cat) (Felis silvestris catus)9685UniRef100_A0A2I3R9Z1
165
A0A2I3LLH3A0A2I3LLH3_PAPANMerlinPapio anubis (Olive baboon)9555UniRef100_A0A2I3R9Z1
165
A0A2K5BVQ7A0A2K5BVQ7_AOTNAFERM domain-containing proteinAotus nancymaae (Ma's night monkey)37293UniRef100_A0A2I3R9Z1
165
A0A4X1VDB9A0A4X1VDB9_PIGFERM domain-containing proteinSus scrofa (Pig)9823UniRef100_A0A2I3R9Z1
165
A0A2K5XBR2A0A2K5XBR2_MANLEFERM domain-containing proteinMandrillus leucophaeus (Drill) (Papio leucophaeus)9568UniRef100_A0A2I3R9Z1
165
A0A2I3GMK0A0A2I3GMK0_NOMLEFERM domain-containing proteinNomascus leucogenys (Northern white-cheeked gibbon) (Hylobates leucogenys)61853UniRef100_A0A2I3R9Z1
165
A0A2I2ZNL6A0A2I2ZNL6_GORGONeurofibromin 2Gorilla gorilla gorilla (Western lowland gorilla)9595UniRef100_A0A2I3R9Z1
165
A0A2K6LL77A0A2K6LL77_RHIBEFERM domain-containing proteinRhinopithecus bieti (Black snub-nosed monkey) (Pygathrix bieti)61621UniRef100_A0A2I3R9Z1
165
A0A2K6FAV5A0A2K6FAV5_PROCOFERM domain-containing proteinPropithecus coquereli (Coquerel's sifaka) (Propithecus verreauxi coquereli)379532UniRef100_A0A2I3R9Z1
165
A0A3Q0EFU0A0A3Q0EFU0_TARSYmerlin isoform X8Tarsius syrichta (Philippine tarsier)1868482UniRef100_A0A2I3R9Z1
165
P35240-9Isoform 9 of MERL_HUMAN9, MER162Homo sapiens (Human)9606UniRef100_A0A2I3R9Z1
165
UPI000BAA2FEFmerlin isoform X6Canis lupus familiaris (Dog) (Canis familiaris)9615UniRef100_UPI000BAA2FEF
179
UPI000905C78Dmerlin isoform X11Panthera pardus (Leopard) (Felis pardus)9691UniRef100_UPI000905C78D
162

Sequence

Representative sequenceiLengthMass (Da)Tools
F6RHZ4

Checksumi: 01B93CD0AFEEB202

FASTA16519,245
        10         20         30         40         50
MAGAIASRMS FSSLKRKQPK TFTVRIVTMD AEMEFNCEMK WKGKDLFDLV
60 70 80 90 100
CRTLGLRETW FFGLQYTIKD TVAWLKMDKK VLDHDVSKEE PVTFHFLAKF
110 120 130 140 150
YPENAEEELV QEITQHLFFL QVKKQILDEK IYCPPEASVL LASYAVQAKL
160
TLQSTKSRVA FFEEL
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again