Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
>UniRef90_F7G1M1 BTB domain-containing protein n=24 Tax=Boreoeutheria TaxID=1437010 RepID=F7G1M1_MACMU MAASGVEKNSKKKTEKKLAAREEAKLLAGFMGVMNNMRKQKTLCDVILMVQERKIPAHRV VLAAASHFFNLMFTTNMLESKSFEVELKDAEPDIIEQLVEFAYTARISVNSNNVQSLLDA ANQYQIEPVKKMCVDFLKEQVDASNCLGEAEKVDQSLPECGMLLAM

Members

Expand cluster to 50% identity.
List component clusters with 100% identity.
1 to 24 of 24  Show
Cluster membersEntry nameProtein names
Organisms
Organism IDsRelated clustersLength
Role
F7G1M1F7G1M1_MACMUBTB domain-containing proteinMacaca mulatta (Rhesus macaque)9544UniRef100_F7G1M1
166Representative
A0A2K6CQI6A0A2K6CQI6_MACNEBTB domain-containing proteinMacaca nemestrina (Pig-tailed macaque)9545UniRef100_F7G1M1
166
A0A3Q0E830A0A3Q0E830_TARSYkelch-like protein 7 isoform X4Tarsius syrichta (Philippine tarsier)1868482UniRef100_A0A3Q0E830
174Seed
A0A2K6FND3A0A2K6FND3_PROCOBTB domain-containing proteinPropithecus coquereli (Coquerel's sifaka) (Propithecus verreauxi coquereli)379532UniRef100_A0A2K6FND3
167
A0A337SU42A0A337SU42_FELCABTB domain-containing proteinFelis catus (Cat) (Felis silvestris catus)9685UniRef100_A0A337SU42
167
A0A2I3LPY3A0A2I3LPY3_PAPANBTB domain-containing proteinPapio anubis (Olive baboon)9555UniRef100_A0A2I3LPY3
166
A0A2K5Z0G8A0A2K5Z0G8_MANLEBTB domain-containing proteinMandrillus leucophaeus (Drill) (Papio leucophaeus)9568UniRef100_A0A2I3LPY3
166
K7CM00K7CM00_PANTRKLHL7 isoform 10Pan troglodytes (Chimpanzee)9598UniRef100_K7CM00
166
A0A2J8VE41A0A2J8VE41_PONABKLHL7 isoform 10Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii)9601UniRef100_K7CM00
166
A0A2R9AFE9A0A2R9AFE9_PANPABTB domain-containing proteinPan paniscus (Pygmy chimpanzee) (Bonobo)9597UniRef100_K7CM00
166
A0A2I3H248A0A2I3H248_NOMLEBTB domain-containing proteinNomascus leucogenys (Northern white-cheeked gibbon) (Hylobates leucogenys)61853UniRef100_K7CM00
166
A0A2I2ZN72A0A2I2ZN72_GORGOKelch like family member 7Gorilla gorilla gorilla (Western lowland gorilla)9595UniRef100_K7CM00
166
Q8IXQ5-3Isoform 3 of KLHL7_HUMAN3Homo sapiens (Human)9606UniRef100_K7CM00
166
A0A2K5X0M1A0A2K5X0M1_MACFABTB domain-containing proteinMacaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)9541UniRef100_A0A2K5X0M1
166
A0A2K5L3J0A0A2K5L3J0_CERATBTB domain-containing proteinCercocebus atys (Sooty mangabey) (Cercocebus torquatus atys)9531UniRef100_A0A2K5L3J0
166
A0A2K6PCF3A0A2K6PCF3_RHIROBTB domain-containing proteinRhinopithecus roxellana (Golden snub-nosed monkey) (Pygathrix roxellana)61622UniRef100_A0A2K6PCF3
166
A0A2K6LAP2A0A2K6LAP2_RHIBEBTB domain-containing proteinRhinopithecus bieti (Black snub-nosed monkey) (Pygathrix bieti)61621UniRef100_A0A2K6PCF3
166
A0A2K5JKJ6A0A2K5JKJ6_COLAPBTB domain-containing proteinColobus angolensis palliatus (Peters' Angolan colobus)336983UniRef100_A0A2K6PCF3
166
A0A2R8MB73A0A2R8MB73_CALJABTB domain-containing proteinCallithrix jacchus (White-tufted-ear marmoset)9483UniRef100_A0A2R8MB73
165
A0A2K5CQK4A0A2K5CQK4_AOTNABTB domain-containing proteinAotus nancymaae (Ma's night monkey)37293UniRef100_A0A2R8MB73
165
A0A2K5RF08A0A2K5RF08_CEBCABTB domain-containing proteinCebus capucinus imitator1737458UniRef100_A0A2K5RF08
161
A0A2K6U7D7A0A2K6U7D7_SAIBBKelch like family member 7Saimiri boliviensis boliviensis (Bolivian squirrel monkey)39432UniRef100_A0A2K6U7D7
161
UPI000C2FEBC0kelch-like protein 7 isoform X4Felis catus (Cat) (Felis silvestris catus)9685UniRef100_UPI000C2FEBC0
167
UPI00045E4653kelch-like protein 7 isoform X4Chlorocebus sabaeus (Green monkey) (Cercopithecus sabaeus)60711UniRef100_UPI00045E4653
166

Sequence

Representative sequenceiLengthMass (Da)Tools
F7G1M1

Checksumi: F7C96A00574DDC59

FASTA16618,563
        10         20         30         40         50
MAASGVEKNS KKKTEKKLAA REEAKLLAGF MGVMNNMRKQ KTLCDVILMV
60 70 80 90 100
QERKIPAHRV VLAAASHFFN LMFTTNMLES KSFEVELKDA EPDIIEQLVE
110 120 130 140 150
FAYTARISVN SNNVQSLLDA ANQYQIEPVK KMCVDFLKEQ VDASNCLGEA
160
EKVDQSLPEC GMLLAM
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again