Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
>UniRef90_F7HD66 DNA polymerase n=23 Tax=Catarrhini TaxID=9526 RepID=F7HD66_MACMU MLMHHQKYLQRFPGRKREKKQKEACSIPGIGKRMAEKIIEILESGHLRKLDHISESVPVL ELFSNIWGAGTKTAQMWYQQGFRSLEDIRSQASLTTQQAIGLKHYNDFLERMPREEATEI EQTVQKAAQAFNSGLLCVACGSYRRGKATCGDVDVLITHPDGRSHRGIFSRLLDSLRQQG FLTDDLVSQEENGQQQKYLGVCRLPGPGWRHRRLDIIVVPYSEFACALLYFTGSAHFNRS MRALAKTKGMSLSEHALSTAVVRNTHGCKMGPGRVLPTPTEKDVFRLLGLPYREPAERDW

Members

Expand cluster to 50% identity.
List component clusters with 100% identity.
1 to 23 of 23  Show
Cluster membersEntry nameProtein names
Organisms
Organism IDsRelated clustersLength
Role
F7HD66F7HD66_MACMUDNA polymeraseMacaca mulatta (Rhesus macaque)9544UniRef100_F7HD66
300Representative
A0A2K5VDF5A0A2K5VDF5_MACFADNA polymeraseMacaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)9541UniRef100_F7HD66
300
A0A2K6BYB2A0A2K6BYB2_MACNEDNA polymeraseMacaca nemestrina (Pig-tailed macaque)9545UniRef100_F7HD66
300
A0A2R9BE07A0A2R9BE07_PANPADNA polymerasePan paniscus (Pygmy chimpanzee) (Bonobo)9597UniRef100_A0A2R9BE07
300
A0A2J8XYD9A0A2J8XYD9_PONABDNA polymerasePongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii)9601UniRef100_A0A2J8XYD9
300
A0A2J8XYE5A0A2J8XYE5_PONABDNA polymerasePongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii)9601UniRef100_A0A2J8XYD9
298
A0A2J8XYD2A0A2J8XYD2_PONABDNA polymerase (Fragment)Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii)9601UniRef100_A0A2J8XYD9
218
A0A2K6PKP5A0A2K6PKP5_RHIRODNA polymeraseRhinopithecus roxellana (Golden snub-nosed monkey) (Pygathrix roxellana)61622UniRef100_A0A2K6PKP5
300
A0A2K6LDV8A0A2K6LDV8_RHIBEDNA polymeraseRhinopithecus bieti (Black snub-nosed monkey) (Pygathrix bieti)61621UniRef100_A0A2K6PKP5
300
A0A2I3S002A0A2I3S002_PANTRDNA polymerasePan troglodytes (Chimpanzee)9598UniRef100_A0A2I3S002
300
A0A2J8PD65A0A2J8PD65_PANTRDNA polymerasePan troglodytes (Chimpanzee)9598UniRef100_A0A2I3S002
298
A0A2J8PD63A0A2J8PD63_PANTRDNA polymerase (Fragment)Pan troglodytes (Chimpanzee)9598UniRef100_A0A2I3S002
218
A0A2I3MZX5A0A2I3MZX5_PAPANDNA polymerasePapio anubis (Olive baboon)9555UniRef100_A0A2I3MZX5
300
A0A2K5LIV1A0A2K5LIV1_CERATDNA polymeraseCercocebus atys (Sooty mangabey) (Cercocebus torquatus atys)9531UniRef100_A0A2I3MZX5
300
A0A2K6ALE0A0A2K6ALE0_MANLEDNA polymeraseMandrillus leucophaeus (Drill) (Papio leucophaeus)9568UniRef100_A0A2I3MZX5
300
A0A2I3H8M0A0A2I3H8M0_NOMLEDNA polymeraseNomascus leucogenys (Northern white-cheeked gibbon) (Hylobates leucogenys)61853UniRef100_A0A2I3H8M0
299
Q5JQP4Q5JQP4_HUMANDNA polymeraseHomo sapiens (Human)9606UniRef100_Q5JQP4
298
Q9UGP5-2Isoform 2 of DPOLL_HUMAN2Homo sapiens (Human)9606UniRef100_Q5JQP4
300
Q5JQP3Q5JQP3_HUMANDNA polymerase (Fragment)Homo sapiens (Human)9606UniRef100_Q5JQP4
218
UPI000D0C91E6DNA polymerase lambda isoform X16Homo sapiens (Human)9606UniRef100_UPI000D0C91E6
344Seed
UPI000D0C73D7DNA polymerase lambda isoform X17Homo sapiens (Human)9606UniRef100_UPI000D0C73D7
337
UPI0005CFFD0BDNA polymerase lambda isoform X20Homo sapiens (Human)9606UniRef100_UPI0005CFFD0B
307
UPI000DC1A97EDNA polymerase lambda isoform X4Theropithecus gelada (Gelada baboon)9565UniRef100_UPI000DC1A97E
300

Sequence

Representative sequenceiLengthMass (Da)Tools
F7HD66

Checksumi: C690E8740F7E7106

FASTA30034,010
        10         20         30         40         50
MLMHHQKYLQ RFPGRKREKK QKEACSIPGI GKRMAEKIIE ILESGHLRKL
60 70 80 90 100
DHISESVPVL ELFSNIWGAG TKTAQMWYQQ GFRSLEDIRS QASLTTQQAI
110 120 130 140 150
GLKHYNDFLE RMPREEATEI EQTVQKAAQA FNSGLLCVAC GSYRRGKATC
160 170 180 190 200
GDVDVLITHP DGRSHRGIFS RLLDSLRQQG FLTDDLVSQE ENGQQQKYLG
210 220 230 240 250
VCRLPGPGWR HRRLDIIVVP YSEFACALLY FTGSAHFNRS MRALAKTKGM
260 270 280 290 300
SLSEHALSTA VVRNTHGCKM GPGRVLPTPT EKDVFRLLGL PYREPAERDW
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again