Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
>UniRef90_G5AM97 F-box only protein 17 n=1 Tax=Heterocephalus glaber TaxID=10181 RepID=G5AM97_HETGA MHSSMRQGLGLWAMLTPLTHAGAVGPEAGAATSSRLAAPSENPAPRASPRARPRFRDLGT AAAMGARPSRRGRPVDPPMALDELPLELLVRVLSYVPPCTLVTRCRAVCRTWREVVDGPT VWLLQLARDRSALYALAQRCPPNSEDEEELPLCALARFSLRAPLRRNLIFNSCGEQGFRG WEVEHGGNGWAVEKNITLVPGAPSQTCFVTSFEWCFKRQLVDLVTEGLWQELLDSAQLEI CVADWWGARENCGCIYRLRVRLLDVYENEVVKFSASPNPVLQWTERTCRQVSHVFTNFGK GIRYVSFEQYGRDTRSWVGHYGALVTHSSVRVRIRLS

Members

Expand cluster to 50% identity.
List component clusters with 100% identity.
1 to 1 of 1  Show
Cluster membersEntry nameProtein names
Organisms
Organism IDsRelated clustersLength
Role
G5AM97G5AM97_HETGAF-box only protein 17Heterocephalus glaber (Naked mole rat)10181UniRef100_G5AM97
337Representative & Seed

Sequence

Representative sequenceiLengthMass (Da)Tools
G5AM97

Checksumi: C129876E4FDC4406

FASTA33737,761
        10         20         30         40         50
MHSSMRQGLG LWAMLTPLTH AGAVGPEAGA ATSSRLAAPS ENPAPRASPR
60 70 80 90 100
ARPRFRDLGT AAAMGARPSR RGRPVDPPMA LDELPLELLV RVLSYVPPCT
110 120 130 140 150
LVTRCRAVCR TWREVVDGPT VWLLQLARDR SALYALAQRC PPNSEDEEEL
160 170 180 190 200
PLCALARFSL RAPLRRNLIF NSCGEQGFRG WEVEHGGNGW AVEKNITLVP
210 220 230 240 250
GAPSQTCFVT SFEWCFKRQL VDLVTEGLWQ ELLDSAQLEI CVADWWGARE
260 270 280 290 300
NCGCIYRLRV RLLDVYENEV VKFSASPNPV LQWTERTCRQ VSHVFTNFGK
310 320 330
GIRYVSFEQY GRDTRSWVGH YGALVTHSSV RVRIRLS
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again