Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
>UniRef90_H2N5H8 MUC1 isoform 22 n=6 Tax=Hominoidea TaxID=314295 RepID=H2N5H8_PONAB MTPGTQSPFFLLLLLTVLTVVTGSGHASSTPGGEKETSATQRSSMPSSTEKNALSVGVSF FFLSFHISNLQFNSSLEDPSTNYYQELQRDISELFLQIYKQGGFLGCSNIKFRPGSVVVQ STLAFREGTTNAHDVETQFNQHKTEAASRYNLTISDIRVSDVPFPFSAQSGAGVPGWGIA LLVLVCVLVALAVVYLIALAVCQCRRKNYGQLDIFPARDAYHPMSEYPTYHTHGRYVPPS STNHSPYEKVSAGNGGSSLSYTNPAVAATSANL

Members

Expand cluster to 50% identity.
List component clusters with 100% identity.
1 to 6 of 6  Show
Cluster membersEntry nameProtein names
Organisms
Organism IDsRelated clustersLength
Role
H2N5H8H2N5H8_PONABMUC1 isoform 22Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii)9601UniRef100_H2N5H8
273Representative & Seed
A0A2J8VGA0A0A2J8VGA0_PONABMUC1 isoform 14Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii)9601UniRef100_A0A2J8VGA0
268
A0A2J8VG97A0A2J8VG97_PONABMUC1 isoform 3Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii)9601UniRef100_A0A2J8VG97
239
A0A2J8VGA4A0A2J8VGA4_PONABMUC1 isoform 21Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii)9601UniRef100_A0A2J8VGA4
230
UPI00020AB248mucin-1 isoform X17Nomascus leucogenys (Northern white-cheeked gibbon) (Hylobates leucogenys)61853UniRef100_UPI00020AB248
230
UPI00020AB24Amucin-1 isoform X19Nomascus leucogenys (Northern white-cheeked gibbon) (Hylobates leucogenys)61853UniRef100_UPI00020AB24A
224

Sequence

Representative sequenceiLengthMass (Da)Tools
H2N5H8

Checksumi: D62B2B9388A62716

FASTA27329,520
        10         20         30         40         50
MTPGTQSPFF LLLLLTVLTV VTGSGHASST PGGEKETSAT QRSSMPSSTE
60 70 80 90 100
KNALSVGVSF FFLSFHISNL QFNSSLEDPS TNYYQELQRD ISELFLQIYK
110 120 130 140 150
QGGFLGCSNI KFRPGSVVVQ STLAFREGTT NAHDVETQFN QHKTEAASRY
160 170 180 190 200
NLTISDIRVS DVPFPFSAQS GAGVPGWGIA LLVLVCVLVA LAVVYLIALA
210 220 230 240 250
VCQCRRKNYG QLDIFPARDA YHPMSEYPTY HTHGRYVPPS STNHSPYEKV
260 270
SAGNGGSSLS YTNPAVAATS ANL
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again