Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
>UniRef90_O14576 Cytoplasmic dynein 1 intermediate chain 1 n=331 Tax=Amniota TaxID=32524 RepID=DC1I1_HUMAN MSDKSDLKAELERKKQRLAQIREEKKRKEEERKKKEADMQQKKEPVQDDSDLDRKRRETE ALLQSIGISPEPPLVQPLHFLTWDTCYFHYLVPTPMSPSSKSVSTPSEAGSQDSGDLGPL TRTLQWDTDPSVLQLQSDSELGRRLHKLGVSKVTQVDFLPREVVSYSKETQTPLATHQSE EDEEDEEMVESKVGQDSELENQDKKQEVKEAPPRELTEEEKQQILHSEEFLIFFDRTIRV IERALAEDSDIFFDYSGRELEEKDGDVQAGANLSFNRQFYDEHWSKHRVVTCMDWSLQYP ELMVASYNNNEDAPHEPDGVALVWNMKFKKTTPEYVFHCQSSVMSVCFARFHPNLVVGGT YSGQIVLWDNRSHRRTPVQRTPLSAAAHTHPVYCVNVVGTQNAHNLITVSTDGKMCSWSL DMLSTPQESMELVYNKSKPVAVTGMAFPTGDVNNFVVGSEEGTVYTACRHGSKAGIGEVF EGHQGPVTGINCHMAVGPIDFSHLFVTSSFDWTVKLWTTKHNKPLYSFEDNADYVYDVMW SPVHPALFACVDGMGRLDLWNLNNDTEVPTASVAIEGASALNRVRWAQAGKEVAVGDSEG RIWVYDVGELAVPHNDEWTRFARTLVEIRANRADSEEEGTVELSA

Members

Expand cluster to 50% identity.
List component clusters with 100% identity.
1 to 25 of 331  Show
Cluster membersEntry nameProtein names
Organisms
Organism IDsRelated clustersLength
Role
O14576DC1I1_HUMANCytoplasmic dynein 1 intermediate chain 1Homo sapiens (Human)9606UniRef100_O14576
645Representative
Q63100DC1I1_RATCytoplasmic dynein 1 intermediate chain 1Rattus norvegicus (Rat)10116UniRef100_Q63100
643
O88485DC1I1_MOUSECytoplasmic dynein 1 intermediate chain 1Mus musculus (Mouse)10090UniRef100_O88485
628
Q29RQ3DC1I1_BOVINCytoplasmic dynein 1 intermediate chain 1Bos taurus (Bovine)9913UniRef100_Q29RQ3
608
A4D1I7A4D1I7_HUMANDynein, cytoplasmic 1, intermediate chain 1, isoform CRA_eHomo sapiens (Human)9606UniRef100_O14576
645
H2QUY9H2QUY9_PANTRDYNC1I1 isoform 4Pan troglodytes (Chimpanzee)9598UniRef100_O14576
645
G3QDB5G3QDB5_GORGODynein cytoplasmic 1 intermediate chain 1Gorilla gorilla gorilla (Western lowland gorilla)9595UniRef100_O14576
645
A0A3Q7P4U9A0A3Q7P4U9_CALURcytoplasmic dynein 1 intermediate chain 1 isoform X2Callorhinus ursinus (Northern fur seal)34884UniRef100_A0A3Q7P4U9
650
G1PND5G1PND5_MYOLUWD_REPEATS_REGION domain-containing proteinMyotis lucifugus (Little brown bat)59463UniRef100_G1PND5
649
A0A1S3GQY5A0A1S3GQY5_DIPORcytoplasmic dynein 1 intermediate chain 1 isoform X1Dipodomys ordii (Ord's kangaroo rat)10020UniRef100_A0A1S3GQY5
645
A0A340WSZ1A0A340WSZ1_LIPVEcytoplasmic dynein 1 intermediate chain 1 isoform X1Lipotes vexillifer (Yangtze river dolphin)118797UniRef100_A0A340WSZ1
645
G1S1E0G1S1E0_NOMLEWD_REPEATS_REGION domain-containing proteinNomascus leucogenys (Northern white-cheeked gibbon) (Hylobates leucogenys)61853UniRef100_G1S1E0
645
H2PMV7H2PMV7_PONABDYNC1I1 isoform 6Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii)9601UniRef100_H2PMV7
645
A0A3Q7TW97A0A3Q7TW97_VULVUcytoplasmic dynein 1 intermediate chain 1 isoform X1Vulpes vulpes (Red fox)9627UniRef100_A0A3Q7TW97
645
A0A2Y9P550A0A2Y9P550_DELLEcytoplasmic dynein 1 intermediate chain 1 isoform X1Delphinapterus leucas (Beluga whale)9749UniRef100_A0A2Y9P550
645
A0A341D7V6A0A341D7V6_9CETAcytoplasmic dynein 1 intermediate chain 1 isoform X1Neophocaena asiaeorientalis asiaeorientalis (Yangtze finless porpoise)1706337UniRef100_A0A341D7V6
645
F6WW23F6WW23_MACMUWD_REPEATS_REGION domain-containing proteinMacaca mulatta (Rhesus macaque)9544UniRef100_F6WW23
645
A0A2K6QBZ0A0A2K6QBZ0_RHIROWD_REPEATS_REGION domain-containing proteinRhinopithecus roxellana (Golden snub-nosed monkey) (Pygathrix roxellana)61622UniRef100_F6WW23
645
A0A2K6A9P1A0A2K6A9P1_MANLEWD_REPEATS_REGION domain-containing proteinMandrillus leucophaeus (Drill) (Papio leucophaeus)9568UniRef100_F6WW23
645
A0A2K5TSG7A0A2K5TSG7_MACFAWD_REPEATS_REGION domain-containing proteinMacaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)9541UniRef100_F6WW23
645
G7P1B9G7P1B9_MACFAWD_REPEATS_REGION domain-containing proteinMacaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)9541UniRef100_F6WW23
645
A0A2K5JH40A0A2K5JH40_COLAPWD_REPEATS_REGION domain-containing proteinColobus angolensis palliatus (Peters' Angolan colobus)336983UniRef100_F6WW23
645
A0A2Y9H0W4A0A2Y9H0W4_NEOSCcytoplasmic dynein 1 intermediate chain 1 isoform X1Neomonachus schauinslandi (Hawaiian monk seal) (Monachus schauinslandi)29088UniRef100_A0A2Y9H0W4
645
A0A2U3WMQ6A0A2U3WMQ6_ODOROcytoplasmic dynein 1 intermediate chain 1 isoform X1Odobenus rosmarus divergens (Pacific walrus)9708UniRef100_A0A2Y9H0W4
645
G5AJS5G5AJS5_HETGACytoplasmic dynein 1 intermediate chain 1Heterocephalus glaber (Naked mole rat)10181UniRef100_G5AJS5
645

Sequence

Representative sequenceiLengthMass (Da)Tools
O14576

Checksumi: 55A6FF971E632DA0

FASTA64572,955
        10         20         30         40         50
MSDKSDLKAE LERKKQRLAQ IREEKKRKEE ERKKKEADMQ QKKEPVQDDS
60 70 80 90 100
DLDRKRRETE ALLQSIGISP EPPLVQPLHF LTWDTCYFHY LVPTPMSPSS
110 120 130 140 150
KSVSTPSEAG SQDSGDLGPL TRTLQWDTDP SVLQLQSDSE LGRRLHKLGV
160 170 180 190 200
SKVTQVDFLP REVVSYSKET QTPLATHQSE EDEEDEEMVE SKVGQDSELE
210 220 230 240 250
NQDKKQEVKE APPRELTEEE KQQILHSEEF LIFFDRTIRV IERALAEDSD
260 270 280 290 300
IFFDYSGREL EEKDGDVQAG ANLSFNRQFY DEHWSKHRVV TCMDWSLQYP
310 320 330 340 350
ELMVASYNNN EDAPHEPDGV ALVWNMKFKK TTPEYVFHCQ SSVMSVCFAR
360 370 380 390 400
FHPNLVVGGT YSGQIVLWDN RSHRRTPVQR TPLSAAAHTH PVYCVNVVGT
410 420 430 440 450
QNAHNLITVS TDGKMCSWSL DMLSTPQESM ELVYNKSKPV AVTGMAFPTG
460 470 480 490 500
DVNNFVVGSE EGTVYTACRH GSKAGIGEVF EGHQGPVTGI NCHMAVGPID
510 520 530 540 550
FSHLFVTSSF DWTVKLWTTK HNKPLYSFED NADYVYDVMW SPVHPALFAC
560 570 580 590 600
VDGMGRLDLW NLNNDTEVPT ASVAIEGASA LNRVRWAQAG KEVAVGDSEG
610 620 630 640
RIWVYDVGEL AVPHNDEWTR FARTLVEIRA NRADSEEEGT VELSA
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again