Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
>UniRef90_O14746-2 Isoform 2 of Telomerase reverse transcriptase n=13 Tax=Catarrhini TaxID=9526 RepID=Isoform 2 of TERT_HUMAN MPRAPRCRAVRSLLRSHYREVLPLATFVRRLGPQGWRLVQRGDPAAFRALVAQCLVCVPW DARPPPAAPSFRQVSCLKELVARVLQRLCERGAKNVLAFGFALLDGARGGPPEAFTTSVR SYLPNTVTDALRGSGAWGLLLRRVGDDVLVHLLARCALFVLVAPSCAYQVCGPPLYQLGA ATQARPPPHASGPRRRLGCERAWNHSVREAGVPLGLPAPGARRRGGSASRSLPLPKRPRR GAAPEPERTPVGQGSWAHPGRTRGPSDRGFCVVSPARPAEEATSLEGALSGTRHSHPSVG RQHHAGPPSTSRPPRPWDTPCPPVYAETKHFLYSSGDKEQLRPSFLLSSLRPSLTGARRL VETIFLGSRPWMPGTPRRLPRLPQRYWQMRPLFLELLGNHAQCPYGVLLKTHCPLRAAVT PAAGVCAREKPQGSVAAPEEEDTDPRRLVQLLRQHSSPWQVYGFVRACLRRLVPPGLWGS RHNERRFLRNTKKFISLGKHAKLSLQELTWKMSVRDCAWLRRSPGVGCVPAAEHRLREEI LAKFLHWLMSVYVVELLRSFFYVTETTFQKNRLFFYRKSVWSKLQSIGIRQHLKRVQLRE LSEAEVRQHREARPALLTSRLRFIPKPDGLRPIVNMDYVVGARTFRREKRAERLTSRVKA LFSVLNYERARRPGLLGASVLGLDDIHRAWRTFVLRVRAQDPPPELYFVKVDVTGAYDTI PQDRLTEVIASIIKPQNTYCVRRYAVVQKAAHGHVRKAFKSHVLRPVPGDPAGLHPLHAA LQPVLRRHGEQAVCGDSAGRAAPAFGG

Members

Expand cluster to 50% identity.
List component clusters with 100% identity.
1 to 13 of 13  Show
Cluster membersEntry nameProtein names
Organisms
Organism IDsRelated clustersLength
Role
O14746-2Isoform 2 of TERT_HUMAN2Homo sapiens (Human)9606UniRef100_O14746-2
807Representative
A0A2J8XSH7A0A2J8XSH7_PONABTelomerase reverse transcriptasePongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii)9601UniRef100_A0A2J8XSH7
820
A0A2K6KYT9A0A2K6KYT9_RHIBETelomerase reverse transcriptaseRhinopithecus bieti (Black snub-nosed monkey) (Pygathrix bieti)61621UniRef100_A0A2K6KYT9
807
A0A2J8JY17A0A2J8JY17_PANTRTelomerase reverse transcriptasePan troglodytes (Chimpanzee)9598UniRef100_A0A2J8JY17
807
A0A2K5V6Q8A0A2K5V6Q8_MACFATelomerase reverse transcriptaseMacaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)9541UniRef100_A0A2K5V6Q8
807
F7GIY1F7GIY1_MACMUTelomerase reverse transcriptaseMacaca mulatta (Rhesus macaque)9544UniRef100_F7GIY1
807
A0A2K6PK41A0A2K6PK41_RHIROTelomerase reverse transcriptaseRhinopithecus roxellana (Golden snub-nosed monkey) (Pygathrix roxellana)61622UniRef100_A0A2K6PK41
807
A0A2I2ZRV9A0A2I2ZRV9_GORGOTelomerase reverse transcriptaseGorilla gorilla gorilla (Western lowland gorilla)9595UniRef100_A0A2I2ZRV9
807
A0A2I3M3G5A0A2I3M3G5_PAPANTelomerase reverse transcriptasePapio anubis (Olive baboon)9555UniRef100_A0A2I3M3G5
807
A0A2K6DK13A0A2K6DK13_MACNETelomerase reverse transcriptaseMacaca nemestrina (Pig-tailed macaque)9545UniRef100_A0A2K6DK13
807
A0A2J8JY06A0A2J8JY06_PANTRTelomerase reverse transcriptasePan troglodytes (Chimpanzee)9598UniRef100_A0A2J8JY06
795
O14746-4Isoform 4 of TERT_HUMAN4Homo sapiens (Human)9606UniRef100_O14746-4
795
UPI000CEFA565LOW QUALITY PROTEIN: telomerase reverse transcriptase-likePongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii)9601UniRef100_UPI000CEFA565
862Seed

Sequence

Representative sequenceiLengthMass (Da)Tools
O14746-2

Checksumi: 199664460CE6D763

FASTA80790,226
        10         20         30         40         50
MPRAPRCRAV RSLLRSHYRE VLPLATFVRR LGPQGWRLVQ RGDPAAFRAL
60 70 80 90 100
VAQCLVCVPW DARPPPAAPS FRQVSCLKEL VARVLQRLCE RGAKNVLAFG
110 120 130 140 150
FALLDGARGG PPEAFTTSVR SYLPNTVTDA LRGSGAWGLL LRRVGDDVLV
160 170 180 190 200
HLLARCALFV LVAPSCAYQV CGPPLYQLGA ATQARPPPHA SGPRRRLGCE
210 220 230 240 250
RAWNHSVREA GVPLGLPAPG ARRRGGSASR SLPLPKRPRR GAAPEPERTP
260 270 280 290 300
VGQGSWAHPG RTRGPSDRGF CVVSPARPAE EATSLEGALS GTRHSHPSVG
310 320 330 340 350
RQHHAGPPST SRPPRPWDTP CPPVYAETKH FLYSSGDKEQ LRPSFLLSSL
360 370 380 390 400
RPSLTGARRL VETIFLGSRP WMPGTPRRLP RLPQRYWQMR PLFLELLGNH
410 420 430 440 450
AQCPYGVLLK THCPLRAAVT PAAGVCAREK PQGSVAAPEE EDTDPRRLVQ
460 470 480 490 500
LLRQHSSPWQ VYGFVRACLR RLVPPGLWGS RHNERRFLRN TKKFISLGKH
510 520 530 540 550
AKLSLQELTW KMSVRDCAWL RRSPGVGCVP AAEHRLREEI LAKFLHWLMS
560 570 580 590 600
VYVVELLRSF FYVTETTFQK NRLFFYRKSV WSKLQSIGIR QHLKRVQLRE
610 620 630 640 650
LSEAEVRQHR EARPALLTSR LRFIPKPDGL RPIVNMDYVV GARTFRREKR
660 670 680 690 700
AERLTSRVKA LFSVLNYERA RRPGLLGASV LGLDDIHRAW RTFVLRVRAQ
710 720 730 740 750
DPPPELYFVK VDVTGAYDTI PQDRLTEVIA SIIKPQNTYC VRRYAVVQKA
760 770 780 790 800
AHGHVRKAFK SHVLRPVPGD PAGLHPLHAA LQPVLRRHGE QAVCGDSAGR

AAPAFGG
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again