Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
>UniRef90_O43315 Aquaporin-9 n=37 Tax=cellular organisms TaxID=131567 RepID=AQP9_HUMAN MQPEGAEKGKSFKQRLVLKSSLAKETLSEFLGTFILIVLGCGCVAQAILSRGRFGGVITI NVGFSMAVAMAIYVAGGVSGGHINPAVSLAMCLFGRMKWFKLPFYVGAQFLGAFVGAATV FGIYYDGLMSFAGGKLLIVGENATAHIFATYPAPYLSLANAFADQVVATMILLIIVFAIF DSRNLGAPRGLEPIAIGLLIIVIASSLGLNSGCAMNPARDLSPRLFTALAGWGFEVFRAG NNFWWIPVVGPLVGAVIGGLIYVLVIEIHHPEPDSVFKTEQSEDKPEKYELSVIM

Members

Expand cluster to 50% identity.
List component clusters with 100% identity.
1 to 25 of 37  Show
Cluster membersEntry nameProtein names
Organisms
Organism IDsRelated clustersLength
Role
O43315AQP9_HUMANAquaporin-9Homo sapiens (Human)9606UniRef100_O43315
295Representative
A0A098YAR4A0A098YAR4_9GAMMUncharacterized protein (Fragment)Acinetobacter idrijaensis1507807UniRef100_O43315
67
H0YK62H0YK62_HUMANAquaporin-9Homo sapiens (Human)9606UniRef100_O43315
230
A0A096NM75A0A096NM75_PAPANUncharacterized proteinPapio anubis (Olive baboon)9555UniRef100_A0A096NM75
297Seed
H2Q9I3H2Q9I3_PANTRAQP9 isoform 1Pan troglodytes (Chimpanzee)9598UniRef100_H2Q9I3
295
A0A2R9CLD4A0A2R9CLD4_PANPAUncharacterized proteinPan paniscus (Pygmy chimpanzee) (Bonobo)9597UniRef100_H2Q9I3
295
A0A2J8NSC8A0A2J8NSC8_PANTRAQP9 isoform 3Pan troglodytes (Chimpanzee)9598UniRef100_H2Q9I3
230
A0A2K5R1E1A0A2K5R1E1_CEBCAUncharacterized proteinCebus capucinus imitator1737458UniRef100_A0A2K5R1E1
295
A0A2K6QAZ3A0A2K6QAZ3_RHIROUncharacterized proteinRhinopithecus roxellana (Golden snub-nosed monkey) (Pygathrix roxellana)61622UniRef100_A0A2K6QAZ3
295
A0A2K6N5X3A0A2K6N5X3_RHIBEUncharacterized proteinRhinopithecus bieti (Black snub-nosed monkey) (Pygathrix bieti)61621UniRef100_A0A2K6QAZ3
295
G1RKK8G1RKK8_NOMLEUncharacterized proteinNomascus leucogenys (Northern white-cheeked gibbon) (Hylobates leucogenys)61853UniRef100_G1RKK8
295
A0A2J8VC98A0A2J8VC98_PONABAQP9 isoform 2Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii)9601UniRef100_A0A2J8VC98
295
A0A2J8VCA0A0A2J8VCA0_PONABAQP9 isoform 1Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii)9601UniRef100_A0A2J8VC98
230
A0A2K5D049A0A2K5D049_AOTNAUncharacterized proteinAotus nancymaae (Ma's night monkey)37293UniRef100_A0A2K5D049
295
A0A2K6DJJ6A0A2K6DJJ6_MACNEUncharacterized proteinMacaca nemestrina (Pig-tailed macaque)9545UniRef100_A0A2K6DJJ6
295
A0A2K5NZI8A0A2K5NZI8_CERATUncharacterized proteinCercocebus atys (Sooty mangabey) (Cercocebus torquatus atys)9531UniRef100_A0A2K5NZI8
295
A0A2K5KA49A0A2K5KA49_COLAPUncharacterized proteinColobus angolensis palliatus (Peters' Angolan colobus)336983UniRef100_A0A2K5KA49
295
F6WY03F6WY03_MACMUAquaporin-9Macaca mulatta (Rhesus macaque)9544UniRef100_F6WY03
295
A0A0D9RHR2A0A0D9RHR2_CHLSBUncharacterized proteinChlorocebus sabaeus (Green monkey) (Cercopithecus sabaeus)60711UniRef100_F6WY03
295
A0A2K5WXJ2A0A2K5WXJ2_MACFAAquaporin-9Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)9541UniRef100_F6WY03
295
G7PBK0G7PBK0_MACFAUncharacterized proteinMacaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)9541UniRef100_F6WY03
295
H2NNC8H2NNC8_PONABUncharacterized proteinPongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii)9601UniRef100_H2NNC8
295
A0A2K6A197A0A2K6A197_MANLEUncharacterized proteinMandrillus leucophaeus (Drill) (Papio leucophaeus)9568UniRef100_A0A2K6A197
295
A0A3Q2I697A0A3Q2I697_HORSEAquaporin 9Equus caballus (Horse)9796UniRef100_A0A3Q2I697
295
G3R8Y0G3R8Y0_GORGOAquaporin 9Gorilla gorilla gorilla (Western lowland gorilla)9595UniRef100_G3R8Y0
295

Sequence

Representative sequenceiLengthMass (Da)Tools
O43315

Checksumi: B3B416CD9F1F9CAF

FASTA29531,431
        10         20         30         40         50
MQPEGAEKGK SFKQRLVLKS SLAKETLSEF LGTFILIVLG CGCVAQAILS
60 70 80 90 100
RGRFGGVITI NVGFSMAVAM AIYVAGGVSG GHINPAVSLA MCLFGRMKWF
110 120 130 140 150
KLPFYVGAQF LGAFVGAATV FGIYYDGLMS FAGGKLLIVG ENATAHIFAT
160 170 180 190 200
YPAPYLSLAN AFADQVVATM ILLIIVFAIF DSRNLGAPRG LEPIAIGLLI
210 220 230 240 250
IVIASSLGLN SGCAMNPARD LSPRLFTALA GWGFEVFRAG NNFWWIPVVG
260 270 280 290
PLVGAVIGGL IYVLVIEIHH PEPDSVFKTE QSEDKPEKYE LSVIM
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again