Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
>UniRef90_O43318-3 Isoform 1C of Mitogen-activated protein kinase kinase kinase 7 n=39 Tax=Eutheria TaxID=9347 RepID=Isoform 3 of M3K7_HUMAN MSTASAASSSSSSSAGEMIEAPSQVLNFEEIDYKEIEVEEVVGRGAFGVVCKAKWRAKDV AIKQIESESERKAFIVELRQLSRVNHPNIVKLYGACLNPVCLVMEYAEGGSLYNVLHGAE PLPYYTAAHAMSWCLQCSQGVAYLHSMQPKALIHRDLKPPNLLLVAGGTVLKICDFGTAC DIQTHMTNNKGSAAWMAPEVFEGSNYSEKCDVFSWGIILWEVITRRKPFDEIGGPAFRIM WAVHNGTRPPLIKNLPKPIESLMTRCWSKDPSQRPSMEEIVKIMTHLMRYFPGADEPLQY PCQYSDEGQSNSATSTGSFMDIASTNTSNKSDTNMEQVPATNDTIKRLESKLLKNQAKQQ SESGRLSLGASRGSSVESLPPTSEGKRMSADMSEIEARIAATTAYSKPKRGHRKTASFGN ILDVPEIVISGNGQPRRRSIQDLTVTGTEPGQVSSRSSSPSVRMITTSGPTSEKPTRSHP WTPDDSTDTNGSDNSIPMAYLTLDHQLQARTSCRTGPG

Members

Expand cluster to 50% identity.
List component clusters with 100% identity.
1 to 25 of 39  Show
Cluster membersEntry nameProtein names
Organisms
Organism IDsRelated clustersLength
Role
O43318-3Isoform 3 of M3K7_HUMAN1CHomo sapiens (Human)9606UniRef100_O43318-3
518Representative
A0A2I3SPY9A0A2I3SPY9_PANTRMitogen-activated protein kinase kinase kinase 7Pan troglodytes (Chimpanzee)9598UniRef100_O43318-3
518
A0A2K6PE98A0A2K6PE98_RHIROMitogen-activated protein kinase kinase kinase 7Rhinopithecus roxellana (Golden snub-nosed monkey) (Pygathrix roxellana)61622UniRef100_O43318-3
518
A0A1D5QVB8A0A1D5QVB8_MACMUMitogen-activated protein kinase kinase kinase 7Macaca mulatta (Rhesus macaque)9544UniRef100_O43318-3
518
A0A2R8ZZW5A0A2R8ZZW5_PANPAMitogen-activated protein kinase kinase kinase 7Pan paniscus (Pygmy chimpanzee) (Bonobo)9597UniRef100_O43318-3
518
A0A2K5ZSV0A0A2K5ZSV0_MANLEMitogen-activated protein kinase kinase kinase 7Mandrillus leucophaeus (Drill) (Papio leucophaeus)9568UniRef100_O43318-3
518
A0A2I2ZAC8A0A2I2ZAC8_GORGOMitogen-activated protein kinase kinase kinase 7Gorilla gorilla gorilla (Western lowland gorilla)9595UniRef100_O43318-3
518
A0A2K5WQ25A0A2K5WQ25_MACFAMitogen-activated protein kinase kinase kinase 7Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)9541UniRef100_O43318-3
518
A0A452U853A0A452U853_URSMAMitogen-activated protein kinase kinase kinase 7Ursus maritimus (Polar bear) (Thalarctos maritimus)29073UniRef100_O43318-3
518
A0A2K6K1P8A0A2K6K1P8_RHIBEMitogen-activated protein kinase kinase kinase 7Rhinopithecus bieti (Black snub-nosed monkey) (Pygathrix bieti)61621UniRef100_O43318-3
518
A0A2K6D8S3A0A2K6D8S3_MACNEMitogen-activated protein kinase kinase kinase 7Macaca nemestrina (Pig-tailed macaque)9545UniRef100_O43318-3
518
A0A2K5HLB4A0A2K5HLB4_COLAPMitogen-activated protein kinase kinase kinase 7Colobus angolensis palliatus (Peters' Angolan colobus)336983UniRef100_O43318-3
518
A0A3Q0DYH6A0A3Q0DYH6_TARSYMitogen-activated protein kinase kinase kinase 7Tarsius syrichta (Philippine tarsier)1868482UniRef100_O43318-3
518
A0A4X1VDV1A0A4X1VDV1_PIGMitogen-activated protein kinase kinase kinase 7Sus scrofa (Pig)9823UniRef100_A0A4X1VDV1
602Seed
A0A2K5QSF9A0A2K5QSF9_CEBCAMitogen-activated protein kinase kinase kinase 7Cebus capucinus imitator1737458UniRef100_A0A2K5QSF9
602
A0A2K6UPM4A0A2K6UPM4_SAIBBMitogen-activated protein kinase kinase kinase 7Saimiri boliviensis boliviensis (Bolivian squirrel monkey)39432UniRef100_A0A2K6UPM4
602
A0A2J8VRV7A0A2J8VRV7_PONABMitogen-activated protein kinase kinase kinase 7Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii)9601UniRef100_A0A2J8VRV7
518
A0A096N156A0A096N156_PAPANMitogen-activated protein kinase kinase kinase 7Papio anubis (Olive baboon)9555UniRef100_A0A2J8VRV7
518
A0A4X1VKK7A0A4X1VKK7_PIGMitogen-activated protein kinase kinase kinase 7Sus scrofa (Pig)9823UniRef100_A0A4X1VKK7
518
A2AP92A2AP92_MOUSEMitogen-activated protein kinase kinase kinase 7Mus musculus (Mouse)10090UniRef100_A2AP92
518
A0A2Y9KUF6A0A2Y9KUF6_ENHLUMitogen-activated protein kinase kinase kinase 7Enhydra lutris kenyoni391180UniRef100_A0A2Y9KUF6
518
A0A2I3H0X8A0A2I3H0X8_NOMLEMitogen-activated protein kinase kinase kinase 7Nomascus leucogenys (Northern white-cheeked gibbon) (Hylobates leucogenys)61853UniRef100_A0A2I3H0X8
518
A0A340WT62A0A340WT62_LIPVEMitogen-activated protein kinase kinase kinase 7Lipotes vexillifer (Yangtze river dolphin)118797UniRef100_A0A340WT62
518
A0A2K5DBW5A0A2K5DBW5_AOTNAMitogen-activated protein kinase kinase kinase 7Aotus nancymaae (Ma's night monkey)37293UniRef100_A0A2K5DBW5
518
A0A2U3W816A0A2U3W816_ODOROMitogen-activated protein kinase kinase kinase 7Odobenus rosmarus divergens (Pacific walrus)9708UniRef100_A0A2U3W816
518

Sequence

Representative sequenceiLengthMass (Da)Tools
O43318-3

Checksumi: A92C927A8621AF90

FASTA51856,706
        10         20         30         40         50
MSTASAASSS SSSSAGEMIE APSQVLNFEE IDYKEIEVEE VVGRGAFGVV
60 70 80 90 100
CKAKWRAKDV AIKQIESESE RKAFIVELRQ LSRVNHPNIV KLYGACLNPV
110 120 130 140 150
CLVMEYAEGG SLYNVLHGAE PLPYYTAAHA MSWCLQCSQG VAYLHSMQPK
160 170 180 190 200
ALIHRDLKPP NLLLVAGGTV LKICDFGTAC DIQTHMTNNK GSAAWMAPEV
210 220 230 240 250
FEGSNYSEKC DVFSWGIILW EVITRRKPFD EIGGPAFRIM WAVHNGTRPP
260 270 280 290 300
LIKNLPKPIE SLMTRCWSKD PSQRPSMEEI VKIMTHLMRY FPGADEPLQY
310 320 330 340 350
PCQYSDEGQS NSATSTGSFM DIASTNTSNK SDTNMEQVPA TNDTIKRLES
360 370 380 390 400
KLLKNQAKQQ SESGRLSLGA SRGSSVESLP PTSEGKRMSA DMSEIEARIA
410 420 430 440 450
ATTAYSKPKR GHRKTASFGN ILDVPEIVIS GNGQPRRRSI QDLTVTGTEP
460 470 480 490 500
GQVSSRSSSP SVRMITTSGP TSEKPTRSHP WTPDDSTDTN GSDNSIPMAY
510
LTLDHQLQAR TSCRTGPG
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again