Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
>UniRef90_O60921 Checkpoint protein HUS1 n=63 Tax=Eutheria TaxID=9347 RepID=HUS1_HUMAN MKFRAKIVDGACLNHFTRISNMIAKLAKTCTLRISPDKLNFILCDKLANGGVSMWCELEQ ENFFNEFQMEGVSAENNEIYLELTSENLSRALKTAQNARALKIKLTNKHFPCLTVSVELL SMSSSSRIVTHDIPIKVIPRKLWKDLQEPVVPDPDVSIYLPVLKTMKSVVEKMKNISNHL VIEANLDGELNLKIETELVCVTTHFKDLGNPPLASESTHEDRNVEHMAEVHIDIRKLLQF LAGQQVNPTKALCNIVNNKMVHFDLLHEDVSLQYFIPALS

Members

Expand cluster to 50% identity.
List component clusters with 100% identity.
1 to 25 of 63  Show
Cluster membersEntry nameProtein names
Organisms
Organism IDsRelated clustersLength
Role
O60921HUS1_HUMANCheckpoint protein HUS1Homo sapiens (Human)9606UniRef100_O60921
280Representative
A4D2F2A4D2F2_HUMANCheckpoint proteinHomo sapiens (Human)9606UniRef100_O60921
280
H2QUJ9H2QUJ9_PANTRCheckpoint proteinPan troglodytes (Chimpanzee)9598UniRef100_O60921
280
A0A2K6Q1B5A0A2K6Q1B5_RHIROCheckpoint proteinRhinopithecus roxellana (Golden snub-nosed monkey) (Pygathrix roxellana)61622UniRef100_A0A2K6Q1B5
280
C9JCK8C9JCK8_HUMANCheckpoint protein HUS1 (Fragment)Homo sapiens (Human)9606UniRef100_A0A2K6Q1B5
183
C9JA95C9JA95_HUMANCheckpoint protein HUS1 (Fragment)Homo sapiens (Human)9606UniRef100_A0A2K6Q1B5
145
A0A2J8U2K9A0A2J8U2K9_PONABHUS1 isoform 8 (Fragment)Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii)9601UniRef100_A0A2K6Q1B5
145
A0A2J8L957A0A2J8L957_PANTRHUS1 isoform 2 (Fragment)Pan troglodytes (Chimpanzee)9598UniRef100_A0A2K6Q1B5
145
A0A2J8U2K8A0A2J8U2K8_PONABHUS1 isoform 6 (Fragment)Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii)9601UniRef100_A0A2K6Q1B5
183
A0A2J8L958A0A2J8L958_PANTRHUS1 isoform 7 (Fragment)Pan troglodytes (Chimpanzee)9598UniRef100_A0A2K6Q1B5
183
A0A2K6LVH9A0A2K6LVH9_RHIBECheckpoint proteinRhinopithecus bieti (Black snub-nosed monkey) (Pygathrix bieti)61621UniRef100_A0A2K6Q1B5
280
A0A096MU54A0A096MU54_PAPANCheckpoint proteinPapio anubis (Olive baboon)9555UniRef100_A0A096MU54
280
A0A2K5MAX3A0A2K5MAX3_CERATCheckpoint proteinCercocebus atys (Sooty mangabey) (Cercocebus torquatus atys)9531UniRef100_A0A096MU54
280
A0A2K5MAT2A0A2K5MAT2_CERATCheckpoint proteinCercocebus atys (Sooty mangabey) (Cercocebus torquatus atys)9531UniRef100_A0A096MU54
259
G7MLB7G7MLB7_MACMUCheckpoint proteinMacaca mulatta (Rhesus macaque)9544UniRef100_G7MLB7
280
A0A2K5U6G8A0A2K5U6G8_MACFACheckpoint proteinMacaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)9541UniRef100_G7MLB7
280
G7P1S9G7P1S9_MACFACheckpoint proteinMacaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)9541UniRef100_G7MLB7
280
H9F1D5H9F1D5_MACMUCheckpoint protein HUS1 (Fragment)Macaca mulatta (Rhesus macaque)9544UniRef100_G7MLB7
116
H9FAV4H9FAV4_MACMUCheckpoint protein HUS1 (Fragment)Macaca mulatta (Rhesus macaque)9544UniRef100_G7MLB7
136
A0A1D5RIF9A0A1D5RIF9_MACMUCheckpoint proteinMacaca mulatta (Rhesus macaque)9544UniRef100_G7MLB7
259
A0A2K5U6L2A0A2K5U6L2_MACFACheckpoint proteinMacaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)9541UniRef100_G7MLB7
259
A0A2K5CRK9A0A2K5CRK9_AOTNACheckpoint proteinAotus nancymaae (Ma's night monkey)37293UniRef100_A0A2K5CRK9
280
A0A0D9RTD7A0A0D9RTD7_CHLSBCheckpoint proteinChlorocebus sabaeus (Green monkey) (Cercopithecus sabaeus)60711UniRef100_A0A0D9RTD7
280
A0A2I3HMZ4A0A2I3HMZ4_NOMLECheckpoint proteinNomascus leucogenys (Northern white-cheeked gibbon) (Hylobates leucogenys)61853UniRef100_A0A2I3HMZ4
280
A0A2J8U2L4A0A2J8U2L4_PONABCheckpoint proteinPongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii)9601UniRef100_A0A2J8U2L4
280

Sequence

Representative sequenceiLengthMass (Da)Tools
O60921

Checksumi: 9C3ED2FD35C2ACB3

FASTA28031,691
        10         20         30         40         50
MKFRAKIVDG ACLNHFTRIS NMIAKLAKTC TLRISPDKLN FILCDKLANG
60 70 80 90 100
GVSMWCELEQ ENFFNEFQME GVSAENNEIY LELTSENLSR ALKTAQNARA
110 120 130 140 150
LKIKLTNKHF PCLTVSVELL SMSSSSRIVT HDIPIKVIPR KLWKDLQEPV
160 170 180 190 200
VPDPDVSIYL PVLKTMKSVV EKMKNISNHL VIEANLDGEL NLKIETELVC
210 220 230 240 250
VTTHFKDLGN PPLASESTHE DRNVEHMAEV HIDIRKLLQF LAGQQVNPTK
260 270 280
ALCNIVNNKM VHFDLLHEDV SLQYFIPALS
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again