Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
>UniRef90_O60938 Keratocan n=61 Tax=Eutheria TaxID=9347 RepID=KERA_HUMAN MAGTICFIMWVLFITDTVWSRSVRQVYEVHDSDDWTIHDFECPMECFCPPSFPTALYCEN RGLKEIPAIPSRIWYLYLQNNLIETIPEKPFENATQLRWINLNKNKITNYGIEKGALSQL KKLLFLFLEDNELEEVPSPLPRSLEQLQLARNKVSRIPQGTFSNLENLTLLDLQNNKLVD NAFQRDTFKGLKNLMQLNMAKNALRNMPPRLPANTMQLFLDNNSIEGIPENYFNVIPKVA FLRLNHNKLSDEGLPSRGFDVSSILDLQLSHNQLTKVPRISAHLQHLHLDHNKIKSVNVS VICPSPSMLPAERDSFSYGPHLRYLRLDGNEIKPPIPMALMTCFRLLQAVII

Members

Expand cluster to 50% identity.
List component clusters with 100% identity.
1 to 25 of 61  Show
Cluster membersEntry nameProtein names
Organisms
Organism IDsRelated clustersLength
Role
O60938KERA_HUMANKeratocanHomo sapiens (Human)9606UniRef100_O60938
352Representative
A0A2Y9FIE4A0A2Y9FIE4_PHYMCkeratocan isoform X1Physeter macrocephalus (Sperm whale) (Physeter catodon)9755UniRef100_A0A2Y9FIE4
392Seed
A0A2Y9FI95A0A2Y9FI95_PHYMCkeratocan isoform X2Physeter macrocephalus (Sperm whale) (Physeter catodon)9755UniRef100_A0A2Y9FIE4
353
F4YE97F4YE97_TURTRKeratocan (Fragment)Tursiops truncatus (Atlantic bottle-nosed dolphin) (Delphinus truncatus)9739UniRef100_A0A2Y9FIE4
115
F2Y609F2Y609_GRAGRKeratocan (Fragment)Grampus griseus (Risso's dolphin) (Delphinus griseus)83653UniRef100_A0A2Y9FIE4
122
F2Y606F2Y606_NEOPHKeratocan (Fragment)Neophocaena phocaenoides (Finless porpoise) (Delphinus phocaenoides)34892UniRef100_A0A2Y9FIE4
122
F2Y614F2Y614_BALOMKeratocan (Fragment)Balaenoptera omurai (Omura's baleen whale)255217UniRef100_A0A2Y9FIE4
122
F2Y607F2Y607_LIPVEKeratocan (Fragment)Lipotes vexillifer (Yangtze river dolphin)118797UniRef100_A0A2Y9FIE4
122
F2Y610F2Y610_STEATKeratocan (Fragment)Stenella attenuata (Pantropical spotted dolphin) (Steno attenuatus)9735UniRef100_A0A2Y9FIE4
122
F2Y608F2Y608_DELCAKeratocan (Fragment)Delphinus capensis (Long-beaked common dolphin)103584UniRef100_A0A2Y9FIE4
122
F2Y613F2Y613_SOUCHKeratocan (Fragment)Sousa chinensis (Indo-pacific humpbacked dolphin) (Steno chinensis)103600UniRef100_A0A2Y9FIE4
122
F2Y612F2Y612_STECOKeratocan (Fragment)Stenella coeruleoalba (Striped dolphin) (Delphinus coeruleoalbus)9737UniRef100_A0A2Y9FIE4
122
F2Y616F2Y616_PLAGNKeratocan (Fragment)Platanista gangetica (Ganges river dolphin) (Platanista gangetica subsp. gangetica)118798UniRef100_A0A2Y9FIE4
122
F2Y941F2Y941_MESDEKeratocan (Fragment)Mesoplodon densirostris (Blainville's beaked whale) (Delphinus densirostris)48708UniRef100_A0A2Y9FIE4
122
F2Y615F2Y615_KOGSIKeratocan (Fragment)Kogia sima (Dwarf sperm whale) (Physeter simus)9752UniRef100_A0A2Y9FIE4
122
A0A340WKD6A0A340WKD6_LIPVEkeratocanLipotes vexillifer (Yangtze river dolphin)118797UniRef100_A0A340WKD6
353
A0A2U4A005A0A2U4A005_TURTRkeratocanTursiops truncatus (Atlantic bottle-nosed dolphin) (Delphinus truncatus)9739UniRef100_A0A2U4A005
353
A0A383YT62A0A383YT62_BALASkeratocanBalaenoptera acutorostrata scammoni (North Pacific minke whale) (Balaenoptera davidsoni)310752UniRef100_A0A383YT62
353
A0A2Y9LS74A0A2Y9LS74_DELLEkeratocan isoform X2Delphinapterus leucas (Beluga whale)9749UniRef100_A0A2Y9LS74
353
A0A341C5U9A0A341C5U9_9CETAkeratocanNeophocaena asiaeorientalis asiaeorientalis (Yangtze finless porpoise)1706337UniRef100_A0A341C5U9
353
A0A4U1F414A0A4U1F414_MONMOLRRNT domain-containing proteinMonodon monoceros (Narwhal) (Ceratodon monodon)40151UniRef100_A0A4U1F414
353
A0A484H0I0A0A484H0I0_SOUCHLRRNT domain-containing proteinSousa chinensis (Indo-pacific humpbacked dolphin) (Steno chinensis)103600UniRef100_A0A484H0I0
353
G1R0P1G1R0P1_NOMLELRRNT domain-containing proteinNomascus leucogenys (Northern white-cheeked gibbon) (Hylobates leucogenys)61853UniRef100_G1R0P1
352
A0A2Y9DZB8A0A2Y9DZB8_TRIMAkeratocanTrichechus manatus latirostris (Florida manatee)127582UniRef100_A0A2Y9DZB8
352
H2NI86H2NI86_PONABKERA isoform 1Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii)9601UniRef100_H2NI86
352

Sequence

Representative sequenceiLengthMass (Da)Tools
O60938

Checksumi: 0CF8DEC938852D28

FASTA35240,509
        10         20         30         40         50
MAGTICFIMW VLFITDTVWS RSVRQVYEVH DSDDWTIHDF ECPMECFCPP
60 70 80 90 100
SFPTALYCEN RGLKEIPAIP SRIWYLYLQN NLIETIPEKP FENATQLRWI
110 120 130 140 150
NLNKNKITNY GIEKGALSQL KKLLFLFLED NELEEVPSPL PRSLEQLQLA
160 170 180 190 200
RNKVSRIPQG TFSNLENLTL LDLQNNKLVD NAFQRDTFKG LKNLMQLNMA
210 220 230 240 250
KNALRNMPPR LPANTMQLFL DNNSIEGIPE NYFNVIPKVA FLRLNHNKLS
260 270 280 290 300
DEGLPSRGFD VSSILDLQLS HNQLTKVPRI SAHLQHLHLD HNKIKSVNVS
310 320 330 340 350
VICPSPSMLP AERDSFSYGP HLRYLRLDGN EIKPPIPMAL MTCFRLLQAV

II
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again