Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
>UniRef90_O95402 Mediator of RNA polymerase II transcription subunit 26 n=52 Tax=Boreoeutheria TaxID=1437010 RepID=MED26_HUMAN MTAAPASPQQIRDRLLQAIDPQSNIRNMVAVLEVISSLEKYPITKEALEETRLGKLINDV RKKTKNEELAKRAKKLLRSWQKLIEPAHQHEAALRGLAGATGSANGGAHNCRPEVGAAGP PRSIHDLKSRNDLQRLPGQRLDRLGSRKRRGDQRDLGHPGPPPKVSKASHDPLVPNSSPL PTNGISGSPESFASSLDGSGHAGPEGSRLERDENDKHSGKIPVNAVRPHTSSPGLGKPPG PCLQPKASVLQQLDRVDETPGPPHPKGPPRCSFSPRNSRHEGSFARQQSLYAPKGSVPSP SPRPQALDATQVPSPLPLAQPSTPPVRRLELLPSAESPVCWLEQPESHQRLAGPGCKAGL SPAEPLLSRAGFSPDSSKADSDAASSGGSDSKKKKRYRPRDYTVNLDGQVAEAGVKPVRL KERKLTFDPMTRQIKPLTQKEPVRADSPVHMEQQSRTELDKQEAKASLQSPFEQTNWKEL SRNEIIQSYLSRQSSLLSSSGAQTPGAHHFMSEYLKQEESTRQGARQLHVLVPQSPPTDL PGLTREVTQDDLDRIQASQWPGVNGCQDTQGNWYDWTQCISLDPHGDDGRLNILPYVCLD

Members

Expand cluster to 50% identity.
List component clusters with 100% identity.
1 to 25 of 52  Show
Cluster membersEntry nameProtein names
Organisms
Organism IDsRelated clustersLength
Role
O95402MED26_HUMANMediator of RNA polymerase II transcription subunit 26Homo sapiens (Human)9606UniRef100_O95402
600Representative
A0A2R9ATF5A0A2R9ATF5_PANPATFIIS N-terminal domain-containing proteinPan paniscus (Pygmy chimpanzee) (Bonobo)9597UniRef100_A0A2R9ATF5
607
A0A2K5ZSW0A0A2K5ZSW0_MANLETFIIS N-terminal domain-containing proteinMandrillus leucophaeus (Drill) (Papio leucophaeus)9568UniRef100_A0A2K5ZSW0
605
A0A2R9ATG3A0A2R9ATG3_PANPATFIIS N-terminal domain-containing proteinPan paniscus (Pygmy chimpanzee) (Bonobo)9597UniRef100_A0A2R9ATG3
603
A0A2R9AXP6A0A2R9AXP6_PANPATFIIS N-terminal domain-containing proteinPan paniscus (Pygmy chimpanzee) (Bonobo)9597UniRef100_A0A2R9ATG3
576
A0A2K6P996A0A2K6P996_RHIROTFIIS N-terminal domain-containing proteinRhinopithecus roxellana (Golden snub-nosed monkey) (Pygathrix roxellana)61622UniRef100_A0A2K6P996
600
A0A2K6E1J4A0A2K6E1J4_MACNETFIIS N-terminal domain-containing proteinMacaca nemestrina (Pig-tailed macaque)9545UniRef100_A0A2K6E1J4
600
B2R9G9B2R9G9_HUMANcDNA, FLJ94385, highly similar to Homo sapiens cofactor required for Sp1 transcriptional activation, subunit 7, 70kDa (CRSP7), mRNAHomo sapiens (Human)9606UniRef100_B2R9G9
600
A0A2K5NJT8A0A2K5NJT8_CERATTFIIS N-terminal domain-containing proteinCercocebus atys (Sooty mangabey) (Cercocebus torquatus atys)9531UniRef100_A0A2K5NJT8
600
F7CC97F7CC97_CALJAMediator of RNA polymerase II transcription subunit 26Callithrix jacchus (White-tufted-ear marmoset)9483UniRef100_F7CC97
600
A0A0D9R074A0A0D9R074_CHLSBTFIIS N-terminal domain-containing proteinChlorocebus sabaeus (Green monkey) (Cercopithecus sabaeus)60711UniRef100_A0A0D9R074
600
A0A2K6KQD5A0A2K6KQD5_RHIBETFIIS N-terminal domain-containing proteinRhinopithecus bieti (Black snub-nosed monkey) (Pygathrix bieti)61621UniRef100_A0A0D9R074
600
A0A2K5J944A0A2K5J944_COLAPTFIIS N-terminal domain-containing proteinColobus angolensis palliatus (Peters' Angolan colobus)336983UniRef100_A0A0D9R074
600
H9ZFJ2H9ZFJ2_MACMUMediator of RNA polymerase II transcription subunit 26Macaca mulatta (Rhesus macaque)9544UniRef100_H9ZFJ2
600
K7BCN6K7BCN6_PANTRMediator complex subunit 26Pan troglodytes (Chimpanzee)9598UniRef100_K7BCN6
600
G3S035G3S035_GORGOTFIIS N-terminal domain-containing proteinGorilla gorilla gorilla (Western lowland gorilla)9595UniRef100_K7BCN6
600
A0A1D5QHY7A0A1D5QHY7_MACMUTFIIS N-terminal domain-containing proteinMacaca mulatta (Rhesus macaque)9544UniRef100_A0A1D5QHY7
600
A0A2I3MXE8A0A2I3MXE8_PAPANTFIIS N-terminal domain-containing proteinPapio anubis (Olive baboon)9555UniRef100_A0A1D5QHY7
600
A0A2K5CFZ4A0A2K5CFZ4_AOTNATFIIS N-terminal domain-containing proteinAotus nancymaae (Ma's night monkey)37293UniRef100_A0A2K5CFZ4
600
A0A2K6T5N5A0A2K6T5N5_SAIBBTFIIS N-terminal domain-containing proteinSaimiri boliviensis boliviensis (Bolivian squirrel monkey)39432UniRef100_A0A2K6T5N5
600
A0A2K5SE77A0A2K5SE77_CEBCATFIIS N-terminal domain-containing proteinCebus capucinus imitator1737458UniRef100_A0A2K5SE77
600
A0A2K5WGY5A0A2K5WGY5_MACFATFIIS N-terminal domain-containing proteinMacaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)9541UniRef100_A0A2K5WGY5
600
G1R0L0G1R0L0_NOMLETFIIS N-terminal domain-containing proteinNomascus leucogenys (Northern white-cheeked gibbon) (Hylobates leucogenys)61853UniRef100_G1R0L0
590
H2QFP8H2QFP8_PANTRTFIIS N-terminal domain-containing proteinPan troglodytes (Chimpanzee)9598UniRef100_H2QFP8
585
G3RJR9G3RJR9_GORGOTFIIS N-terminal domain-containing proteinGorilla gorilla gorilla (Western lowland gorilla)9595UniRef100_H2QFP8
585

Sequence

Representative sequenceiLengthMass (Da)Tools
O95402

Checksumi: 4BEA264A3EB5A407

FASTA60065,446
        10         20         30         40         50
MTAAPASPQQ IRDRLLQAID PQSNIRNMVA VLEVISSLEK YPITKEALEE
60 70 80 90 100
TRLGKLINDV RKKTKNEELA KRAKKLLRSW QKLIEPAHQH EAALRGLAGA
110 120 130 140 150
TGSANGGAHN CRPEVGAAGP PRSIHDLKSR NDLQRLPGQR LDRLGSRKRR
160 170 180 190 200
GDQRDLGHPG PPPKVSKASH DPLVPNSSPL PTNGISGSPE SFASSLDGSG
210 220 230 240 250
HAGPEGSRLE RDENDKHSGK IPVNAVRPHT SSPGLGKPPG PCLQPKASVL
260 270 280 290 300
QQLDRVDETP GPPHPKGPPR CSFSPRNSRH EGSFARQQSL YAPKGSVPSP
310 320 330 340 350
SPRPQALDAT QVPSPLPLAQ PSTPPVRRLE LLPSAESPVC WLEQPESHQR
360 370 380 390 400
LAGPGCKAGL SPAEPLLSRA GFSPDSSKAD SDAASSGGSD SKKKKRYRPR
410 420 430 440 450
DYTVNLDGQV AEAGVKPVRL KERKLTFDPM TRQIKPLTQK EPVRADSPVH
460 470 480 490 500
MEQQSRTELD KQEAKASLQS PFEQTNWKEL SRNEIIQSYL SRQSSLLSSS
510 520 530 540 550
GAQTPGAHHF MSEYLKQEES TRQGARQLHV LVPQSPPTDL PGLTREVTQD
560 570 580 590 600
DLDRIQASQW PGVNGCQDTQ GNWYDWTQCI SLDPHGDDGR LNILPYVCLD
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again