Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
>UniRef90_P05627 Transcription factor AP-1 n=11 Tax=Boreoeutheria TaxID=1437010 RepID=JUN_MOUSE MTAKMETTFYDDALNASFLQSESGAYGYSNPKILKQSMTLNLADPVGSLKPHLRAKNSDL LTSPDVGLLKLASPELERLIIQSSNGHITTTPTPTQFLCPKNVTDEQEGFAEGFVRALAE LHSQNTLPSVTSAAQPVSGAGMVAPAVASVAGAGGGGGYSASLHSEPPVYANLSNFNPGA LSSGGGAPSYGAAGLAFPSQPQQQQQPPQPPHHLPQQIPVQHPRLQALKEEPQTVPEMPG ETPPLSPIDMESQERIKAERKRMRNRIAASKCRKRKLERIARLEEKVKTLKAQNSELAST ANMLREQVAQLKQKVMNHVNSGCQLMLTQQLQTF

Members

Expand cluster to 50% identity.
List component clusters with 100% identity.
1 to 11 of 11  Show
Cluster membersEntry nameProtein names
Organisms
Organism IDsRelated clustersLength
Role
P05627JUN_MOUSETranscription factor AP-1Mus musculus (Mouse)10090UniRef100_P05627
334Representative
P17325JUN_RATTranscription factor AP-1Rattus norvegicus (Rat)10116UniRef100_P17325
334
Q52L79Q52L79_MOUSEJun proteinMus musculus (Mouse)10090UniRef100_P05627
334
A0A1U8BXK4A0A1U8BXK4_MESAUtranscription factor AP-1Mesocricetus auratus (Golden hamster)10036UniRef100_A0A1U8BXK4
338Seed
Q3V255Q3V255_MOUSEBZIP domain-containing proteinMus musculus (Mouse)10090UniRef100_Q3V255
334
Q3US19Q3US19_MOUSEBZIP domain-containing proteinMus musculus (Mouse)10090UniRef100_Q3US19
334
A0A4X1WB31A0A4X1WB31_PIGTranscription factor AP-1Sus scrofa (Pig)9823UniRef100_A0A4X1WB31
331
A0A1A6GXV6A0A1A6GXV6_NEOLEBZIP domain-containing proteinNeotoma lepida (Desert woodrat)56216UniRef100_A0A1A6GXV6
330
UPI000F33A660transcription factor AP-1Cricetulus griseus (Chinese hamster) (Cricetulus barabensis griseus)10029UniRef100_UPI000F33A660
334
UPI00038BFD47transcription factor AP-1Microtus ochrogaster (Prairie vole)79684UniRef100_UPI00038BFD47
333
UPI000A304626transcription factor AP-1Mus caroli (Ryukyu mouse) (Ricefield mouse)10089UniRef100_A0A1A6GXV6
334

Sequence

Representative sequenceiLengthMass (Da)Tools
P05627

Checksumi: 2BE0E4025B8B1CA3

FASTA33435,944
        10         20         30         40         50
MTAKMETTFY DDALNASFLQ SESGAYGYSN PKILKQSMTL NLADPVGSLK
60 70 80 90 100
PHLRAKNSDL LTSPDVGLLK LASPELERLI IQSSNGHITT TPTPTQFLCP
110 120 130 140 150
KNVTDEQEGF AEGFVRALAE LHSQNTLPSV TSAAQPVSGA GMVAPAVASV
160 170 180 190 200
AGAGGGGGYS ASLHSEPPVY ANLSNFNPGA LSSGGGAPSY GAAGLAFPSQ
210 220 230 240 250
PQQQQQPPQP PHHLPQQIPV QHPRLQALKE EPQTVPEMPG ETPPLSPIDM
260 270 280 290 300
ESQERIKAER KRMRNRIAAS KCRKRKLERI ARLEEKVKTL KAQNSELAST
310 320 330
ANMLREQVAQ LKQKVMNHVN SGCQLMLTQQ LQTF
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again