Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
>UniRef90_P08529 50S ribosomal protein L14, chloroplastic n=798 Tax=cellular organisms TaxID=131567 RepID=RK14_MAIZE MIQPQTLLNVADNSGARKLMCIRVIGAAGNQRYARIGDVIIAVIKDAVPQMPLERSEVIR AVIVRTRKEFKGDDGIIIRYDDNAAVIIDQKGNPKGTRVFGAVAEELRELNLTKIVSLAP EVL

Members

Expand cluster to 50% identity.
List component clusters with 100% identity.
1 to 25 of 798  Show
Cluster membersEntry nameProtein names
Organisms
Organism IDsRelated clustersLength
Role
P08529RK14_MAIZE50S ribosomal protein L14, chloroplasticZea mays (Maize)4577UniRef100_P08529
123Representative
B3TN86RK14_BRADI50S ribosomal protein L14, chloroplasticBrachypodium distachyon (Purple false brome) (Trachynia distachya)15368UniRef100_B3TN86
123
Q6L3G2RK14_SACHY50S ribosomal protein L14, chloroplasticSaccharum hybrid (Sugarcane)15819UniRef100_Q6L3G2
123
Q6ENS7RK14_SACOF50S ribosomal protein L14, chloroplasticSaccharum officinarum (Sugarcane)4547UniRef100_Q6L3G2
123
Q6END7RK14_ORYNI50S ribosomal protein L14, chloroplasticOryza nivara (Indian wild rice) (Oryza sativa f. spontanea)4536UniRef100_Q6END7
123
P0C438RK14_ORYSA50S ribosomal protein L14, chloroplasticOryza sativa (Rice)4530UniRef100_Q6END7
123
P0C439RK14_ORYSI50S ribosomal protein L14, chloroplasticOryza sativa subsp. indica (Rice)39946UniRef100_Q6END7
123
P0C440RK14_ORYSJ50S ribosomal protein L14, chloroplasticOryza sativa subsp. japonica (Rice)39947UniRef100_Q6END7
123
A1E9W1RK14_SORBI50S ribosomal protein L14, chloroplasticSorghum bicolor (Sorghum) (Sorghum vulgare)4558UniRef100_A1E9W1
123
A1EA45RK14_AGRST50S ribosomal protein L14, chloroplasticAgrostis stolonifera (Creeping bentgrass)63632UniRef100_A1EA45
123
A1E9M7RK14_HORVU50S ribosomal protein L14, chloroplasticHordeum vulgare (Barley)4513UniRef100_A1EA45
123
A8Y9C3RK14_LOLPR50S ribosomal protein L14, chloroplasticLolium perenne (Perennial ryegrass)4522UniRef100_A1EA45
123
Q95H51RK14_WHEAT50S ribosomal protein L14, chloroplasticTriticum aestivum (Wheat)4565UniRef100_Q95H51
123
A0A059Q6Y4A0A059Q6Y4_MAIZE50S ribosomal protein L14, chloroplasticZea mays subsp. mays (maize)381124UniRef100_P08529
123
A0A172FJG3A0A172FJG3_ZEAMHRibosomal protein L14Zea mays subsp. huehuetenangensis (San Antonio Huista teosinte)112001UniRef100_P08529
123
T1N0H2T1N0H2_TRIUAUncharacterized proteinTriticum urartu (Red wild einkorn) (Crithodium urartu)4572UniRef100_T1N0H2
127Seed
A0A3Q8JFU4A0A3Q8JFU4_9POAL50S ribosomal protein L14, chloroplasticAndropogon mannii2491218UniRef100_A0A3Q8JFU4
123
A0A0Q3I8W5A0A0Q3I8W5_BRADI50S ribosomal protein L14, chloroplasticBrachypodium distachyon (Purple false brome) (Trachynia distachya)15368UniRef100_B3TN86
123
A0A2K4MZM4A0A2K4MZM4_BRADI50S ribosomal protein L14, chloroplasticBrachypodium distachyon (Purple false brome) (Trachynia distachya)15368UniRef100_A0A2K4MZM4
123
A0A2I9B2U0A0A2I9B2U0_9POAL50S ribosomal protein L14, chloroplasticBrachypodium hybridum1071398UniRef100_A0A2K4MZM4
123
A0A220IPC3A0A220IPC3_BRAPI50S ribosomal protein L14, chloroplasticBrachypodium pinnatum (Tor grass) (Bromus pinnatus)29663UniRef100_A0A2K4MZM4
123
A0A2K4MWW4A0A2K4MWW4_9POAL50S ribosomal protein L14, chloroplasticBrachypodium stacei1071399UniRef100_A0A2K4MZM4
123
A0A1Y0AC45A0A1Y0AC45_9POAL50S ribosomal protein L14, chloroplasticKerriochloa siamensis796746UniRef100_A0A1Y0AC45
123
A0A1S6M1W5A0A1S6M1W5_9ORYZ50S ribosomal protein L14, chloroplasticLeersia perrieri77586UniRef100_A0A1S6M1W5
123
A0A1W5HZ14A0A1W5HZ14_9ORYZ50S ribosomal protein L14, chloroplasticLeersia japonica463890UniRef100_A0A1S6M1W5
123

Sequence

Representative sequenceiLengthMass (Da)Tools
P08529

Checksumi: D5489FF50FF95C9D

FASTA12313,494
        10         20         30         40         50
MIQPQTLLNV ADNSGARKLM CIRVIGAAGN QRYARIGDVI IAVIKDAVPQ
60 70 80 90 100
MPLERSEVIR AVIVRTRKEF KGDDGIIIRY DDNAAVIIDQ KGNPKGTRVF
110 120
GAVAEELREL NLTKIVSLAP EVL
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again