Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
>UniRef90_P11087 Collagen alpha-1(I) chain n=24 Tax=cellular organisms TaxID=131567 RepID=CO1A1_MOUSE MFSFVDLRLLLLLGATALLTHGQEDIPEVSCIHNGLRVPNGETWKPEVCLICICHNGTAV CDDVQCNEELDCPNPQRREGECCAFCPEEYVSPNSEDVGVEGPKGDPGPQGPRGPVGPPG RDGIPGQPGLPGPPGPPGPPGPPGLGGNFASQMSYGYDEKSAGVSVPGPMGPSGPRGLPG PPGAPGPQGFQGPPGEPGEPGGSGPMGPRGPPGPPGKNGDDGEAGKPGRPGERGPPGPQG ARGLPGTAGLPGMKGHRGFSGLDGAKGDAGPAGPKGEPGSPGENGAPGQMGPRGLPGERG RPGPPGTAGARGNDGAVGAAGPPGPTGPTGPPGFPGAVGAKGEAGPQGARGSEGPQGVRG EPGPPGPAGAAGPAGNPGADGQPGAKGANGAPGIAGAPGFPGARGPSGPQGPSGPPGPKG NSGEPGAPGNKGDTGAKGEPGATGVQGPPGPAGEEGKRGARGEPGPSGLPGPPGERGGPG SRGFPGADGVAGPKGPSGERGAPGPAGPKGSPGEAGRPGEAGLPGAKGLTGSPGSPGPDG KTGPPGPAGQDGRPGPAGPPGARGQAGVMGFPGPKGTAGEPGKAGERGLPGPPGAVGPAG KDGEAGAQGAPGPAGPAGERGEQGPAGSPGFQGLPGPAGPPGEAGKPGEQGVPGDLGAPG PSGARGERGFPGERGVQGPPGPAGPRGNNGAPGNDGAKGDTGAPGAPGSQGAPGLQGMPG ERGAAGLPGPKGDRGDAGPKGADGSPGKDGARGLTGPIGPPGPAGAPGDKGEAGPSGPPG PTGARGAPGDRGEAGPPGPAGFAGPPGADGQPGAKGEPGDTGVKGDAGPPGPAGPAGPPG PIGNVGAPGPKGPRGAAGPPGATGFPGAAGRVGPPGPSGNAGPPGPPGPVGKEGGKGPRG ETGPAGRPGEVGPPGPPGPAGEKGSPGADGPAGSPGTPGPQGIAGQRGVVGLPGQRGERG FPGLPGPSGEPGKQGPSGSSGERGPPGPMGPPGLAGPPGESGREGSPGAEGSPGRDGAPG AKGDRGETGPAGPPGAPGAPGAPGPVGPAGKNGDRGETGPAGPAGPIGPAGARGPAGPQG PRGDKGETGEQGDRGIKGHRGFSGLQGPPGSPGSPGEQGPSGASGPAGPRGPPGSAGSPG KDGLNGLPGPIGPPGPRGRTGDSGPAGPPGPPGPPGPPGPPSGGYDFSFLPQPPQEKSQD GGRYYRADDANVVRDRDLEVDTTLKSLSQQIENIRSPEGSRKNPARTCRDLKMCHSDWKS GEYWIDPNQGCNLDAIKVYCNMETGQTCVFPTQPSVPQKNWYISPNPKEKKHVWFGESMT DGFPFEYGSEGSDPADVAIQLTFLRLMSTEASQNITYHCKNSVAYMDQQTGNLKKALLLQ GSNEIELRGEGNSRFTYSTLVDGCTSHTGTWGKTVIEYKTTKTSRLPIIDVAPLDIGAPD QEFGLDIGPACFV

Members

Expand cluster to 50% identity.
List component clusters with 100% identity.
1 to 24 of 24  Show
Cluster membersEntry nameProtein names
Organisms
Organism IDsRelated clustersLength
Role
P11087CO1A1_MOUSECollagen alpha-1(I) chainMus musculus (Mouse)10090UniRef100_P11087
1,453Representative
P02454CO1A1_RATCollagen alpha-1(I) chainRattus norvegicus (Rat)10116UniRef100_P02454
1,453
A0A1X9FNI7A0A1X9FNI7_9MURIType I collagen alpha 1 chain (Fragment)Mus sp.10095UniRef100_P11087
323
Q99LL6Q99LL6_MOUSECol1a1 protein (Fragment)Mus musculus (Mouse)10090UniRef100_P11087
589
Q61022Q61022_MOUSEAlpha-1 type 1 collagen (Fragment)Mus musculus (Mouse)10090UniRef100_P11087
92
Q64353Q64353_MOUSEAlpha-1 type I collagen, exons 1 and 2 (Fragment)Mus musculus (Mouse)10090UniRef100_P11087
29
A0A1S3GXN3A0A1S3GXN3_DIPORcollagen alpha-1(I) chainDipodomys ordii (Ord's kangaroo rat)10020UniRef100_A0A1S3GXN3
1,462
A0A5E4BST3A0A5E4BST3_MARMOUncharacterized proteinMarmota monax (Woodchuck)9995UniRef100_A0A5E4BST3
1,462
A0A328B4W1A0A328B4W1_9CAULUncharacterized protein (Fragment)Phenylobacterium kunshanense1445034UniRef100_P02454
180
A0A068F650A0A068F650_RATType I-alpha 1 collagen (Fragment)Rattus norvegicus (Rat)10116UniRef100_P02454
233
A0A1U7QKK9A0A1U7QKK9_MESAUcollagen alpha-1(I) chain isoform X1Mesocricetus auratus (Golden hamster)10036UniRef100_A0A1U7QKK9
1,453
P11087-2Isoform 2 of CO1A1_MOUSE2Mus musculus (Mouse)10090UniRef100_P11087-2
1,225
UPI0004ED280Dcollagen alpha-1(I) chain isoform X1Nannospalax galili (Northern Israeli blind subterranean mole rat) (Spalax galili)1026970UniRef100_UPI0004ED280D
1,463Seed
UPI000E55D284collagen alpha-1(I) chainUrocitellus parryii (Arctic ground squirrel) (Spermophilus parryii)9999UniRef100_UPI000E55D284
1,462
UPI00045E115Dcollagen alpha-1(I) chainOrycteropus afer afer1230840UniRef100_UPI00045E115D
1,460
UPI000A30C2A9collagen alpha-1(I) chainMus pahari (Gairdner's shrew-mouse) (Coelomys pahari)10093UniRef100_UPI000A30C2A9
1,453
UPI000A317529collagen alpha-1(I) chainMus caroli (Ryukyu mouse) (Ricefield mouse)10089UniRef100_UPI000A317529
1,452
UPI00081A2124collagen alpha-1(I) chain isoform X2Nannospalax galili (Northern Israeli blind subterranean mole rat) (Spalax galili)1026970UniRef100_UPI00081A2124
1,373
UPI00038C4802collagen alpha-1(I) chainIctidomys tridecemlineatus (Thirteen-lined ground squirrel) (Spermophilus tridecemlineatus)43179UniRef100_UPI00038C4802
1,349
UPI00111C6553collagen alpha-1(I) chain isoform X3Nannospalax galili (Northern Israeli blind subterranean mole rat) (Spalax galili)1026970UniRef100_UPI00111C6553
1,244
UPI00111C3A8Fcollagen alpha-1(I) chain isoform X4Nannospalax galili (Northern Israeli blind subterranean mole rat) (Spalax galili)1026970UniRef100_UPI00111C3A8F
1,202
UPI0007629245collagen alpha-1(I) chain isoform X2Marmota marmota marmota (Alpine marmot)9994UniRef100_UPI0007629245
1,201
UPI001113D335collagen-like proteinAcinetobacter baumannii470UniRef100_UPI001113D335
107
UPI00109FA4C8collagen alpha-1(I) chainGrammomys surdaster491861UniRef100_UPI001113D335
1,454

Sequence

Representative sequenceiLengthMass (Da)Tools
P11087

Checksumi: 0B7F06BBB9A1D5EA

FASTA1,453138,033
        10         20         30         40         50
MFSFVDLRLL LLLGATALLT HGQEDIPEVS CIHNGLRVPN GETWKPEVCL
60 70 80 90 100
ICICHNGTAV CDDVQCNEEL DCPNPQRREG ECCAFCPEEY VSPNSEDVGV
110 120 130 140 150
EGPKGDPGPQ GPRGPVGPPG RDGIPGQPGL PGPPGPPGPP GPPGLGGNFA
160 170 180 190 200
SQMSYGYDEK SAGVSVPGPM GPSGPRGLPG PPGAPGPQGF QGPPGEPGEP
210 220 230 240 250
GGSGPMGPRG PPGPPGKNGD DGEAGKPGRP GERGPPGPQG ARGLPGTAGL
260 270 280 290 300
PGMKGHRGFS GLDGAKGDAG PAGPKGEPGS PGENGAPGQM GPRGLPGERG
310 320 330 340 350
RPGPPGTAGA RGNDGAVGAA GPPGPTGPTG PPGFPGAVGA KGEAGPQGAR
360 370 380 390 400
GSEGPQGVRG EPGPPGPAGA AGPAGNPGAD GQPGAKGANG APGIAGAPGF
410 420 430 440 450
PGARGPSGPQ GPSGPPGPKG NSGEPGAPGN KGDTGAKGEP GATGVQGPPG
460 470 480 490 500
PAGEEGKRGA RGEPGPSGLP GPPGERGGPG SRGFPGADGV AGPKGPSGER
510 520 530 540 550
GAPGPAGPKG SPGEAGRPGE AGLPGAKGLT GSPGSPGPDG KTGPPGPAGQ
560 570 580 590 600
DGRPGPAGPP GARGQAGVMG FPGPKGTAGE PGKAGERGLP GPPGAVGPAG
610 620 630 640 650
KDGEAGAQGA PGPAGPAGER GEQGPAGSPG FQGLPGPAGP PGEAGKPGEQ
660 670 680 690 700
GVPGDLGAPG PSGARGERGF PGERGVQGPP GPAGPRGNNG APGNDGAKGD
710 720 730 740 750
TGAPGAPGSQ GAPGLQGMPG ERGAAGLPGP KGDRGDAGPK GADGSPGKDG
760 770 780 790 800
ARGLTGPIGP PGPAGAPGDK GEAGPSGPPG PTGARGAPGD RGEAGPPGPA
810 820 830 840 850
GFAGPPGADG QPGAKGEPGD TGVKGDAGPP GPAGPAGPPG PIGNVGAPGP
860 870 880 890 900
KGPRGAAGPP GATGFPGAAG RVGPPGPSGN AGPPGPPGPV GKEGGKGPRG
910 920 930 940 950
ETGPAGRPGE VGPPGPPGPA GEKGSPGADG PAGSPGTPGP QGIAGQRGVV
960 970 980 990 1000
GLPGQRGERG FPGLPGPSGE PGKQGPSGSS GERGPPGPMG PPGLAGPPGE
1010 1020 1030 1040 1050
SGREGSPGAE GSPGRDGAPG AKGDRGETGP AGPPGAPGAP GAPGPVGPAG
1060 1070 1080 1090 1100
KNGDRGETGP AGPAGPIGPA GARGPAGPQG PRGDKGETGE QGDRGIKGHR
1110 1120 1130 1140 1150
GFSGLQGPPG SPGSPGEQGP SGASGPAGPR GPPGSAGSPG KDGLNGLPGP
1160 1170 1180 1190 1200
IGPPGPRGRT GDSGPAGPPG PPGPPGPPGP PSGGYDFSFL PQPPQEKSQD
1210 1220 1230 1240 1250
GGRYYRADDA NVVRDRDLEV DTTLKSLSQQ IENIRSPEGS RKNPARTCRD
1260 1270 1280 1290 1300
LKMCHSDWKS GEYWIDPNQG CNLDAIKVYC NMETGQTCVF PTQPSVPQKN
1310 1320 1330 1340 1350
WYISPNPKEK KHVWFGESMT DGFPFEYGSE GSDPADVAIQ LTFLRLMSTE
1360 1370 1380 1390 1400
ASQNITYHCK NSVAYMDQQT GNLKKALLLQ GSNEIELRGE GNSRFTYSTL
1410 1420 1430 1440 1450
VDGCTSHTGT WGKTVIEYKT TKTSRLPIID VAPLDIGAPD QEFGLDIGPA

CFV
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again