Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
>UniRef90_P11590 Major urinary protein 4 n=4 Tax=Mus TaxID=862507 RepID=MUP4_MOUSE MKLLLCLGLTLVCIHAEEATSKGQNLNVEKINGEWFSILLASDKREKIEEHGSMRVFVEH IHVLENSLAFKFHTVIDGECSEIFLVADKTEKAGEYSVMYDGFNTFTILKTDYDNYIMFH LINEKDGKTFQLMELYGRKADLNSDIKEKFVKLCEEHGIIKENIIDLTKTNRCLKARE

Members

Expand cluster to 50% identity.
List component clusters with 100% identity.
1 to 4 of 4  Show
Cluster membersEntry nameProtein names
Organisms
Organism IDsRelated clustersLength
Role
P11590MUP4_MOUSEMajor urinary protein 4Mus musculus (Mouse)10090UniRef100_P11590
178Representative
A2ANT5A2ANT5_MOUSEMajor urinary protein 1Mus musculus (Mouse)10090UniRef100_P11590
178
UPI0001D63BE1Major urinary protein 4Mus musculus (Mouse)10090UniRef100_P11590
162
UPI000A3199F9major urinary protein 4Mus caroli (Ryukyu mouse) (Ricefield mouse)10089UniRef100_UPI000A3199F9
179Seed

Sequence

Representative sequenceiLengthMass (Da)Tools
P11590

Checksumi: F0ACF73F17D5A57C

FASTA17820,542
        10         20         30         40         50
MKLLLCLGLT LVCIHAEEAT SKGQNLNVEK INGEWFSILL ASDKREKIEE
60 70 80 90 100
HGSMRVFVEH IHVLENSLAF KFHTVIDGEC SEIFLVADKT EKAGEYSVMY
110 120 130 140 150
DGFNTFTILK TDYDNYIMFH LINEKDGKTF QLMELYGRKA DLNSDIKEKF
160 170
VKLCEEHGII KENIIDLTKT NRCLKARE
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again