Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
>UniRef90_P19263 Mediator of RNA polymerase II transcription subunit 14 n=10 Tax=Saccharomyces TaxID=4930 RepID=MED14_YEAST MTTTIGSPQMLANEERLSNEMHALKNRSEQNGQEQQGPVKNTQLHGPSATDPETTATQKE SLEMVPKDTSAATMTSAPPPALPHVEINQVSLALVIRNLTVFTMKELAQYMKTNVHTQAN EPNSAKKIRFLQLIIFLRTQFLKLYVLVKWTRTIKQNNFHVLIDLLNWFRTTNMNVNNCI WALKSSLNSMTNAKLPNVDLVTALEVLSLGRPNLPTHNFKLSGVSNSMDMVDGMAKVPIG LILQRLKDLNLTVSIKIALMNIPKPLNSYHIKNGRIYFTVPNEFEIQLSTVNRQSPLFFV DLKLLFNTEAEQTVSAVTEATSTNGDSENNEENSSSNGNNLPLNKPRLEKLINEILLKSN DPLLSLYNFLHKYVLTLQLYMVHREFLKLANGGKFSKSNLIHNYDSKKSTITVRYWLNGK MDSKGKITIGIQRTTESLILKWDNQSASRAKNMPVIYNNIVSNIEGILDEIMFNHARIIR SELLARDIFQEDEENSDVLLFQLPTTCVSMAPIQLKIDLLSGQFYFRNPTPLLSNYASKI NRAEGPEELARILQQLKLDKIIHVLTTMFENTGWSCSRIIKIDKPIRTQVNTGGESVVKK EDNKYAIAGNSTTNSDVSLLLQRDLFIRLPHWPLNWYLILSIISSKTSCVVEKRIGKIVS QRGKWNLKYLDNSNVMTVKLESITYQKIMILQRTILNRIINHMLIDSLNQLEIRNKICSS EMINEQKLPQYIIQGSNTNDNISIITLELESFLEGSKALNSILESSMFLRIDYSNSQIRL YAKFKRNTMMIQCQIDKLYIHFVQEEPLAFYLEESFTNLGIIVQYLTKFRQKLMQLVVLT DVVERLHKNFESENFKIIALQPNEISFKYLSNNDEDDKDCTIKISTNDDSIKNLTVQLSP SNPQHIIQPFLDNSKMDYHFIFSYLQFTSSLFKALKVILNERGGKFHESGSQYSTMVNIG LHNLNEYQIVYYNPQAGTKITICIELKTVLHNGRDKIQFHIHFADVAHITTKSPAYPMMH QVRNQVFMLDTKRLGTPESVKPANASHAIRLGNGVACDPSEIEPILMEIHNILKVDSNSS SS

Members

Expand cluster to 50% identity.
List component clusters with 100% identity.
1 to 10 of 10  Show
Cluster membersEntry nameProtein names
Organisms
Organism IDsRelated clustersLength
Role
P19263MED14_YEASTMediator of RNA polymerase II transcription subunit 14Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)559292UniRef100_P19263
1,082Representative & Seed
C7GQP6C7GQP6_YEAS2Mediator of RNA polymerase II transcription subunit 14Saccharomyces cerevisiae (strain JAY291) (Baker's yeast)574961UniRef100_C7GQP6
1,082
G2WIR3G2WIR3_YEASKMediator of RNA polymerase II transcription subunit 14Saccharomyces cerevisiae (strain Kyokai no. 7 / NBRC 101557) (Baker's yeast)721032UniRef100_G2WIR3
1,082
N1P112N1P112_YEASCMediator of RNA polymerase II transcription subunit 14Saccharomyces cerevisiae (strain CEN.PK113-7D) (Baker's yeast)889517UniRef100_N1P112
1,082
B5VN03B5VN03_YEAS6Mediator of RNA polymerase II transcription subunit 14Saccharomyces cerevisiae (strain AWRI1631) (Baker's yeast)545124UniRef100_B5VN03
1,082
A7A0X6A7A0X6_YEAS7Mediator of RNA polymerase II transcription subunit 14Saccharomyces cerevisiae (strain YJM789) (Baker's yeast)307796UniRef100_B5VN03
1,082
A0A0L8REC0A0A0L8REC0_SACEUMediator of RNA polymerase II transcription subunit 14Saccharomyces eubayanus (Yeast)1080349UniRef100_A0A0L8REC0
1,082
H0GY49H0GY49_SACCKMediator of RNA polymerase II transcription subunit 14Saccharomyces cerevisiae x Saccharomyces kudriavzevii (strain VIN7) (Yeast)1095631UniRef100_H0GY49
1,081
A0A0L8VKV7A0A0L8VKV7_9SACHMediator of RNA polymerase II transcription subunit 14Saccharomyces sp. 'boulardii'252598UniRef100_A0A0L8VKV7
1,073
UPI000D53C2F9Mediator of RNA polymerase II transcription subunit 14Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)559292UniRef100_P19263
745

Sequence

Representative sequenceiLengthMass (Da)Tools
P19263

Checksumi: 96277001829DB539

FASTA1,082123,358
        10         20         30         40         50
MTTTIGSPQM LANEERLSNE MHALKNRSEQ NGQEQQGPVK NTQLHGPSAT
60 70 80 90 100
DPETTATQKE SLEMVPKDTS AATMTSAPPP ALPHVEINQV SLALVIRNLT
110 120 130 140 150
VFTMKELAQY MKTNVHTQAN EPNSAKKIRF LQLIIFLRTQ FLKLYVLVKW
160 170 180 190 200
TRTIKQNNFH VLIDLLNWFR TTNMNVNNCI WALKSSLNSM TNAKLPNVDL
210 220 230 240 250
VTALEVLSLG RPNLPTHNFK LSGVSNSMDM VDGMAKVPIG LILQRLKDLN
260 270 280 290 300
LTVSIKIALM NIPKPLNSYH IKNGRIYFTV PNEFEIQLST VNRQSPLFFV
310 320 330 340 350
DLKLLFNTEA EQTVSAVTEA TSTNGDSENN EENSSSNGNN LPLNKPRLEK
360 370 380 390 400
LINEILLKSN DPLLSLYNFL HKYVLTLQLY MVHREFLKLA NGGKFSKSNL
410 420 430 440 450
IHNYDSKKST ITVRYWLNGK MDSKGKITIG IQRTTESLIL KWDNQSASRA
460 470 480 490 500
KNMPVIYNNI VSNIEGILDE IMFNHARIIR SELLARDIFQ EDEENSDVLL
510 520 530 540 550
FQLPTTCVSM APIQLKIDLL SGQFYFRNPT PLLSNYASKI NRAEGPEELA
560 570 580 590 600
RILQQLKLDK IIHVLTTMFE NTGWSCSRII KIDKPIRTQV NTGGESVVKK
610 620 630 640 650
EDNKYAIAGN STTNSDVSLL LQRDLFIRLP HWPLNWYLIL SIISSKTSCV
660 670 680 690 700
VEKRIGKIVS QRGKWNLKYL DNSNVMTVKL ESITYQKIMI LQRTILNRII
710 720 730 740 750
NHMLIDSLNQ LEIRNKICSS EMINEQKLPQ YIIQGSNTND NISIITLELE
760 770 780 790 800
SFLEGSKALN SILESSMFLR IDYSNSQIRL YAKFKRNTMM IQCQIDKLYI
810 820 830 840 850
HFVQEEPLAF YLEESFTNLG IIVQYLTKFR QKLMQLVVLT DVVERLHKNF
860 870 880 890 900
ESENFKIIAL QPNEISFKYL SNNDEDDKDC TIKISTNDDS IKNLTVQLSP
910 920 930 940 950
SNPQHIIQPF LDNSKMDYHF IFSYLQFTSS LFKALKVILN ERGGKFHESG
960 970 980 990 1000
SQYSTMVNIG LHNLNEYQIV YYNPQAGTKI TICIELKTVL HNGRDKIQFH
1010 1020 1030 1040 1050
IHFADVAHIT TKSPAYPMMH QVRNQVFMLD TKRLGTPESV KPANASHAIR
1060 1070 1080
LGNGVACDPS EIEPILMEIH NILKVDSNSS SS
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again