Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
>UniRef90_P19659 Mediator of RNA polymerase II transcription subunit 15 n=12 Tax=Saccharomyces TaxID=4930 RepID=MED15_YEAST MSAAPVQDKDTLSNAERAKNVNGLLQVLMDINTLNGGSSDTADKIRIHAKNFEAALFAKS SSKKEYMDSMNEKVAVMRNTYNTRKNAVTAAAANNNIKPVEQHHINNLKNSGNSANNMNV NMNLNPQMFLNQQAQARQQVAQQLRNQQQQQQQQQQQQRRQLTPQQQQLVNQMKVAPIPK QLLQRIPNIPPNINTWQQVTALAQQKLLTPQDMEAAKEVYKIHQQLLFKARLQQQQAQAQ AQANNNNNGLPQNGNINNNINIPQQQQMQPPNSSANNNPLQQQSSQNTVPNVLNQINQIF SPEEQRSLLQEAIETCKNFEKTQLGSTMTEPVKQSFIRKYINQKALRKIQALRDVKNNNN ANNNGSNLQRAQNVPMNIIQQQQQQNTNNNDTIATSATPNAAAFSQQQNASSKLYQMQQQ QQAQAQAQAQAQAQAQAQAQAQAAQAAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQ AHAQHQPSQQPQQAQQQPNPLHGLTPTAKDVEVIKQLSLDASKTNLRLTDVTNSLSNEEK EKIKMKLKQGQKLFVQVSNFAPQVYIITKNENFLKEVFQLRIFVKEILEKCAEGIFVVKL DTVDRLIIKYQKYWESMRIQILRRQAILRQQQQMANNNGNPGTTSTGNNNNIATQQNMQQ SLQQMQHLQQLKMQQQQQQQQQQQQQQQQQQQQQQQHIYPSSTPGVANYSAMANAPGNNI PYMNHKNTSSMDFLNSMENTPKVPVSAAATPSLNKTINGKVNGRTKSNTIPVTSIPSTNK KLSISNAASQQPTPRSASNTAKSTPNTNPSPLKTQTKNGTPNPNNMKTVQSPMGAQPSYN SAIIENAFRKEELLLKDLEIRKLEISSRFKHRQEIFKDSPMDLFMSTLGDCLGIKDEEML TSCTIPKAVVDHINGSGKRKPTKAAQRARDQDSIDISIKDNKLVMKSKFNKSNRSYSIAL SNVAAIFKGIGGNFKDLSTLVHSSSPSTSSNMDVGNPRKRKASVLEISPQDSIASVLSPD SNIMSDSKKIKVDSPDDPFMTKSGATTSEKQEVTNEAPFLTSGTSSEQFNVWDWNNWTSA T

Members

Expand cluster to 50% identity.
List component clusters with 100% identity.
1 to 12 of 12  Show
Cluster membersEntry nameProtein names
Organisms
Organism IDsRelated clustersLength
Role
P19659MED15_YEASTMediator of RNA polymerase II transcription subunit 15Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)559292UniRef100_P19659
1,081Representative
N1NWC1N1NWC1_YEASCGal11pSaccharomyces cerevisiae (strain CEN.PK113-7D) (Baker's yeast)889517UniRef100_P19659
1,081
C8ZHR3C8ZHR3_YEAS8Gal11pSaccharomyces cerevisiae (strain Lalvin EC1118 / Prise de mousse) (Baker's yeast)643680UniRef100_C8ZHR3
1,096Seed
B5VRK1B5VRK1_YEAS6YOL051Wp-like protein (Fragment)Saccharomyces cerevisiae (strain AWRI1631) (Baker's yeast)545124UniRef100_C8ZHR3
263
A6ZNG0A6ZNG0_YEAS7Mediator complex subunitSaccharomyces cerevisiae (strain YJM789) (Baker's yeast)307796UniRef100_A6ZNG0
1,096
G2WMI4G2WMI4_YEASKK7_Gal11pSaccharomyces cerevisiae (strain Kyokai no. 7 / NBRC 101557) (Baker's yeast)721032UniRef100_G2WMI4
1,093
B3LJ09B3LJ09_YEAS1RNA polymerase II holoenzyme complex componentSaccharomyces cerevisiae (strain RM11-1a) (Baker's yeast)285006UniRef100_B3LJ09
1,090
B5VRK2B5VRK2_YEAS6YOL051Wp-like protein (Fragment)Saccharomyces cerevisiae (strain AWRI1631) (Baker's yeast)545124UniRef100_B3LJ09
590
A0A0L8VHS1A0A0L8VHS1_9SACHGAL11p Subunit of the RNA polymerase II mediator complexSaccharomyces sp. 'boulardii'252598UniRef100_A0A0L8VHS1
1,088
H0GN71H0GN71_SACCKGal11pSaccharomyces cerevisiae x Saccharomyces kudriavzevii (strain VIN7) (Yeast)1095631UniRef100_H0GN71
1,085
UPI000D097F07Mediator of RNA polymerase II transcription subunit 15Saccharomyces cerevisiae (Baker's yeast)4932UniRef100_C8ZHR3
92
UPI0001753A7CMediator of RNA polymerase II transcription subunit 15Saccharomyces cerevisiae (Baker's yeast)4932UniRef100_A6ZNG0
85

Sequence

Representative sequenceiLengthMass (Da)Tools
P19659

Checksumi: 275C78721B5415C7

FASTA1,081120,308
        10         20         30         40         50
MSAAPVQDKD TLSNAERAKN VNGLLQVLMD INTLNGGSSD TADKIRIHAK
60 70 80 90 100
NFEAALFAKS SSKKEYMDSM NEKVAVMRNT YNTRKNAVTA AAANNNIKPV
110 120 130 140 150
EQHHINNLKN SGNSANNMNV NMNLNPQMFL NQQAQARQQV AQQLRNQQQQ
160 170 180 190 200
QQQQQQQQRR QLTPQQQQLV NQMKVAPIPK QLLQRIPNIP PNINTWQQVT
210 220 230 240 250
ALAQQKLLTP QDMEAAKEVY KIHQQLLFKA RLQQQQAQAQ AQANNNNNGL
260 270 280 290 300
PQNGNINNNI NIPQQQQMQP PNSSANNNPL QQQSSQNTVP NVLNQINQIF
310 320 330 340 350
SPEEQRSLLQ EAIETCKNFE KTQLGSTMTE PVKQSFIRKY INQKALRKIQ
360 370 380 390 400
ALRDVKNNNN ANNNGSNLQR AQNVPMNIIQ QQQQQNTNNN DTIATSATPN
410 420 430 440 450
AAAFSQQQNA SSKLYQMQQQ QQAQAQAQAQ AQAQAQAQAQ AQAAQAAQAQ
460 470 480 490 500
AQAQAQAQAQ AQAQAQAQAQ AQAQAQAQAQ AHAQHQPSQQ PQQAQQQPNP
510 520 530 540 550
LHGLTPTAKD VEVIKQLSLD ASKTNLRLTD VTNSLSNEEK EKIKMKLKQG
560 570 580 590 600
QKLFVQVSNF APQVYIITKN ENFLKEVFQL RIFVKEILEK CAEGIFVVKL
610 620 630 640 650
DTVDRLIIKY QKYWESMRIQ ILRRQAILRQ QQQMANNNGN PGTTSTGNNN
660 670 680 690 700
NIATQQNMQQ SLQQMQHLQQ LKMQQQQQQQ QQQQQQQQQQ QQQQQQHIYP
710 720 730 740 750
SSTPGVANYS AMANAPGNNI PYMNHKNTSS MDFLNSMENT PKVPVSAAAT
760 770 780 790 800
PSLNKTINGK VNGRTKSNTI PVTSIPSTNK KLSISNAASQ QPTPRSASNT
810 820 830 840 850
AKSTPNTNPS PLKTQTKNGT PNPNNMKTVQ SPMGAQPSYN SAIIENAFRK
860 870 880 890 900
EELLLKDLEI RKLEISSRFK HRQEIFKDSP MDLFMSTLGD CLGIKDEEML
910 920 930 940 950
TSCTIPKAVV DHINGSGKRK PTKAAQRARD QDSIDISIKD NKLVMKSKFN
960 970 980 990 1000
KSNRSYSIAL SNVAAIFKGI GGNFKDLSTL VHSSSPSTSS NMDVGNPRKR
1010 1020 1030 1040 1050
KASVLEISPQ DSIASVLSPD SNIMSDSKKI KVDSPDDPFM TKSGATTSEK
1060 1070 1080
QEVTNEAPFL TSGTSSEQFN VWDWNNWTSA T
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again