Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
>UniRef90_P21525 Transcription factor kayak, isoforms A/B/F n=4 Tax=melanogaster subgroup TaxID=32351 RepID=FOSLA_DROME MKNLNGRTHNACYHPYYHQSLHFAQQQQQQQQHHLQQQQQHMQQQQQQQQAPQQQLRHQQ RQLPTQPAYQQSQSVAHNAFPLRSSSNNYGHVASSAYAASSGSHNSNNAAAMAAVCQMQN FFNQQQQQQQQLEFNNNCMPINYYQQQQQQHYPSESQSSASGWNPETPGQAQLALTATTC NTTAAATCNTTAAATTSTTATSAAAGSDNNHSDNFAMDASEIATFLANELFLQQLGNFET GQSVLTLTTPTLTPTTTRNIEDTLGHLLSDTQTDRVAGCAGFAVPKVLPNAIDVLGMGIP TGVSSLPLQQTFDLSLGQGSESEDSNASYNDTQMNEEQDTTDTSSAHTDSTSYQAGHIMA GSVNGGGVNNFSNVLAAVSSSRGSASVGSSNANTSNTPARRGGGRRPNRSTNMTPEEEQK RAVRRERNKQAAARCRKRRVDQTNELTEEVEQLEKRGESMRKEIEVLTNSKNQLEYLLAT HRATCQKIRSDMLSVVTCNGLIAPAGLLSAGSSGSGASSHHNHNSNDSSNGTITGMDATL NSTGRSNSPLDLKPAANIDSLLMHIKDEPLDGAIDSGSSLDQDGPPPSKRITLPPMSTMP HVHLSTILTPTGASSGSLQTPITSTAPGGFGSAFPVTSNGSSINNINSIGNNMNSPTLNA HNKVPKERPNTLAFQRPLGQMHLTMANNKAGGPTQIQGVPIQTPSTGTFNFDSLMDGGTG LTPVSGPLVPNSSSTNKHPLELPTPTAEPSKLVSL

Members

Expand cluster to 50% identity.
List component clusters with 100% identity.
1 to 4 of 4  Show
Cluster membersEntry nameProtein names
Organisms
Organism IDsRelated clustersLength
Role
P21525FOSLA_DROMETranscription factor kayak, isoforms A/B/FDrosophila melanogaster (Fruit fly)7227UniRef100_P21525
755Representative
A0A0R1E9K8A0A0R1E9K8_DROYAUncharacterized protein, isoform DDrosophila yakuba (Fruit fly)7245UniRef100_A0A0R1E9K8
771Seed
UPI0007327AB7transcription factor kayak isoform X1Drosophila erecta (Fruit fly)7220UniRef100_UPI0007327AB7
757
UPI00078AE671uncharacterized protein, isoform DDrosophila simulans (Fruit fly)7240UniRef100_UPI00078AE671
748

Sequence

Representative sequenceiLengthMass (Da)Tools
P21525

Checksumi: 6E21F0460B626DAA

FASTA75580,579
        10         20         30         40         50
MKNLNGRTHN ACYHPYYHQS LHFAQQQQQQ QQHHLQQQQQ HMQQQQQQQQ
60 70 80 90 100
APQQQLRHQQ RQLPTQPAYQ QSQSVAHNAF PLRSSSNNYG HVASSAYAAS
110 120 130 140 150
SGSHNSNNAA AMAAVCQMQN FFNQQQQQQQ QLEFNNNCMP INYYQQQQQQ
160 170 180 190 200
HYPSESQSSA SGWNPETPGQ AQLALTATTC NTTAAATCNT TAAATTSTTA
210 220 230 240 250
TSAAAGSDNN HSDNFAMDAS EIATFLANEL FLQQLGNFET GQSVLTLTTP
260 270 280 290 300
TLTPTTTRNI EDTLGHLLSD TQTDRVAGCA GFAVPKVLPN AIDVLGMGIP
310 320 330 340 350
TGVSSLPLQQ TFDLSLGQGS ESEDSNASYN DTQMNEEQDT TDTSSAHTDS
360 370 380 390 400
TSYQAGHIMA GSVNGGGVNN FSNVLAAVSS SRGSASVGSS NANTSNTPAR
410 420 430 440 450
RGGGRRPNRS TNMTPEEEQK RAVRRERNKQ AAARCRKRRV DQTNELTEEV
460 470 480 490 500
EQLEKRGESM RKEIEVLTNS KNQLEYLLAT HRATCQKIRS DMLSVVTCNG
510 520 530 540 550
LIAPAGLLSA GSSGSGASSH HNHNSNDSSN GTITGMDATL NSTGRSNSPL
560 570 580 590 600
DLKPAANIDS LLMHIKDEPL DGAIDSGSSL DQDGPPPSKR ITLPPMSTMP
610 620 630 640 650
HVHLSTILTP TGASSGSLQT PITSTAPGGF GSAFPVTSNG SSINNINSIG
660 670 680 690 700
NNMNSPTLNA HNKVPKERPN TLAFQRPLGQ MHLTMANNKA GGPTQIQGVP
710 720 730 740 750
IQTPSTGTFN FDSLMDGGTG LTPVSGPLVP NSSSTNKHPL ELPTPTAEPS

KLVSL
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again