Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
>UniRef90_P24001 Interleukin-32 n=25 Tax=Homininae TaxID=207598 RepID=IL32_HUMAN MCFPKVLSDDMKKLKARMVMLLPTSAQGLGAWVSACDTEDTVGHLGPWRDKDPALWCQLC LSSQHQAIERFYDKMQNAESGRGQVMSSLAELEDDFKEGYLETVAAYYEEQHPELTPLLE KERDGLRCRGNRSPVPDVEDPATEEPGESFCDKVMRWFQAMLQRLQTWWHGVLAWVKEKV VALVHAVQALWKQFQSFCCSLSELFMSSFQSYGAPRGDKEELTPQKCSEPQSSK

Members

Expand cluster to 50% identity.
List component clusters with 100% identity.
1 to 25 of 25  Show
Cluster membersEntry nameProtein names
Organisms
Organism IDsRelated clustersLength
Role
P24001IL32_HUMANInterleukin-32Homo sapiens (Human)9606UniRef100_P24001
234Representative & Seed
F8VSD2F8VSD2_HUMANInterleukin-32 (Fragment)Homo sapiens (Human)9606UniRef100_P24001
225
C6GKH2C6GKH2_HUMANInterleukin-32 smallHomo sapiens (Human)9606UniRef100_P24001
80
A0A2I2Z5L2A0A2I2Z5L2_GORGOInterleukin 32Gorilla gorilla gorilla (Western lowland gorilla)9595UniRef100_A0A2I2Z5L2
234
A0A2R9CSP2A0A2R9CSP2_PANPAUncharacterized proteinPan paniscus (Pygmy chimpanzee) (Bonobo)9597UniRef100_A0A2R9CSP2
234
A0A2J8LB80A0A2J8LB80_PANTRIL32 isoform 13Pan troglodytes (Chimpanzee)9598UniRef100_A0A2J8LB80
234
A0A2J8LB86A0A2J8LB86_PANTRIL32 isoform 31 (Fragment)Pan troglodytes (Chimpanzee)9598UniRef100_A0A2J8LB80
225
A0A2I3SUF7A0A2I3SUF7_PANTRIL32 isoform 28Pan troglodytes (Chimpanzee)9598UniRef100_A0A2I3SUF7
225
F8VVN4F8VVN4_HUMANInterleukin-32Homo sapiens (Human)9606UniRef100_F8VVN4
225
G3S3Y9G3S3Y9_GORGOInterleukin 32Gorilla gorilla gorilla (Western lowland gorilla)9595UniRef100_G3S3Y9
225
A0A2R9CMY2A0A2R9CMY2_PANPAUncharacterized proteinPan paniscus (Pygmy chimpanzee) (Bonobo)9597UniRef100_A0A2R9CMY2
225
A0A2I3TJ10A0A2I3TJ10_PANTRInterleukin 32Pan troglodytes (Chimpanzee)9598UniRef100_A0A2I3TJ10
224
G3RRF0G3RRF0_GORGOInterleukin 32Gorilla gorilla gorilla (Western lowland gorilla)9595UniRef100_G3RRF0
222
A0A2I3RR19A0A2I3RR19_PANTRIL32 isoform 1Pan troglodytes (Chimpanzee)9598UniRef100_A0A2I3RR19
221
E9PIV2E9PIV2_HUMANInterleukin-32Homo sapiens (Human)9606UniRef100_E9PIV2
221
A0A2I2YE65A0A2I2YE65_GORGOInterleukin 32Gorilla gorilla gorilla (Western lowland gorilla)9595UniRef100_A0A2I2YE65
221
A0A2R9CKE3A0A2R9CKE3_PANPAUncharacterized proteinPan paniscus (Pygmy chimpanzee) (Bonobo)9597UniRef100_A0A2R9CKE3
221
A0A2J8LB82A0A2J8LB82_PANTRIL32 isoform 26Pan troglodytes (Chimpanzee)9598UniRef100_A0A2J8LB82
212
F8W1V1F8W1V1_HUMANInterleukin-32Homo sapiens (Human)9606UniRef100_F8W1V1
212
A0A2I3SGE6A0A2I3SGE6_PANTRUncharacterized proteinPan troglodytes (Chimpanzee)9598UniRef100_A0A2I3SGE6
193
A0A2I3RS92A0A2I3RS92_PANTRIL32 isoform 17Pan troglodytes (Chimpanzee)9598UniRef100_A0A2I3RS92
188
P24001-2Isoform 2 of IL32_HUMAN2, BetaHomo sapiens (Human)9606UniRef100_P24001-2
188
P24001-3Isoform 3 of IL32_HUMAN3, DeltaHomo sapiens (Human)9606UniRef100_P24001-2
178
A0A2I2ZAF6A0A2I2ZAF6_GORGOInterleukin 32Gorilla gorilla gorilla (Western lowland gorilla)9595UniRef100_A0A2I2ZAF6
188
A0A2R9CKH2A0A2R9CKH2_PANPAUncharacterized proteinPan paniscus (Pygmy chimpanzee) (Bonobo)9597UniRef100_A0A2R9CKH2
188

Sequence

Representative sequenceiLengthMass (Da)Tools
P24001

Checksumi: 5F339FE2D348A761

FASTA23426,676
        10         20         30         40         50
MCFPKVLSDD MKKLKARMVM LLPTSAQGLG AWVSACDTED TVGHLGPWRD
60 70 80 90 100
KDPALWCQLC LSSQHQAIER FYDKMQNAES GRGQVMSSLA ELEDDFKEGY
110 120 130 140 150
LETVAAYYEE QHPELTPLLE KERDGLRCRG NRSPVPDVED PATEEPGESF
160 170 180 190 200
CDKVMRWFQA MLQRLQTWWH GVLAWVKEKV VALVHAVQAL WKQFQSFCCS
210 220 230
LSELFMSSFQ SYGAPRGDKE ELTPQKCSEP QSSK
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again