Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
>UniRef90_P32004 Neural cell adhesion molecule L1 n=175 Tax=Boreoeutheria TaxID=1437010 RepID=L1CAM_HUMAN MVVALRYVWPLLLCSPCLLIQIPEEYEGHHVMEPPVITEQSPRRLVVFPTDDISLKCEAS GKPEVQFRWTRDGVHFKPKEELGVTVYQSPHSGSFTITGNNSNFAQRFQGIYRCFASNKL GTAMSHEIRLMAEGAPKWPKETVKPVEVEEGESVVLPCNPPPSAEPLRIYWMNSKILHIK QDERVTMGQNGNLYFANVLTSDNHSDYICHAHFPGTRTIIQKEPIDLRVKATNSMIDRKP RLLFPTNSSSHLVALQGQPLVLECIAEGFPTPTIKWLRPSGPMPADRVTYQNHNKTLQLL KVGEEDDGEYRCLAENSLGSARHAYYVTVEAAPYWLHKPQSHLYGPGETARLDCQVQGRP QPEVTWRINGIPVEELAKDQKYRIQRGALILSNVQPSDTMVTQCEARNRHGLLLANAYIY VVQLPAKILTADNQTYMAVQGSTAYLLCKAFGAPVPSVQWLDEDGTTVLQDERFFPYANG TLGIRDLQANDTGRYFCLAANDQNNVTIMANLKVKDATQITQGPRSTIEKKGSRVTFTCQ ASFDPSLQPSITWRGDGRDLQELGDSDKYFIEDGRLVIHSLDYSDQGNYSCVASTELDVV ESRAQLLVVGSPGPVPRLVLSDLHLLTQSQVRVSWSPAEDHNAPIEKYDIEFEDKEMAPE KWYSLGKVPGNQTSTTLKLSPYVHYTFRVTAINKYGPGEPSPVSETVVTPEAAPEKNPVD VKGEGNETTNMVITWKPLRWMDWNAPQVQYRVQWRPQGTRGPWQEQIVSDPFLVVSNTST FVPYEIKVQAVNSQGKGPEPQVTIGYSGEDYPQAIPELEGIEILNSSAVLVKWRPVDLAQ VKGHLRGYNVTYWREGSQRKHSKRHIHKDHVVVPANTTSVILSGLRPYSSYHLEVQAFNG RGSGPASEFTFSTPEGVPGHPEALHLECQSNTSLLLRWQPPLSHNGVLTGYVLSYHPLDE GGKGQLSFNLRDPELRTHNLTDLSPHLRYRFQLQATTKEGPGEAIVREGGTMALSGISDF GNISATAGENYSVVSWVPKEGQCNFRFHILFKALGEEKGGASLSPQYVSYNQSSYTQWDL QPDTDYEIHLFKERMFRHQMAVKTNGTGRVRLPPAGFATEGWFIGFVSAIILLLLVLLIL CFIKRSKGGKYSVKDKEDTQVDSEARPMKDETFGEYRSLESDNEEKAFGSSQPSLNGDIK PLGSDDSLADYGGSVDVQFNEDGSFIGQYSGKKEKEAAGGNDSSGATSPINPAVALE

Members

Expand cluster to 50% identity.
List component clusters with 100% identity.
1 to 25 of 175  Show
Cluster membersEntry nameProtein names
Organisms
Organism IDsRelated clustersLength
Role
P32004L1CAM_HUMANNeural cell adhesion molecule L1Homo sapiens (Human)9606UniRef100_P32004
1,257Representative
Q7Z3Z9Q7Z3Z9_HUMANL1 cell adhesion molecule (Fragment)Homo sapiens (Human)9606UniRef100_P32004
1,255
Q7Z2J9Q7Z2J9_HUMANL1 cell adhesion molecule (Fragment)Homo sapiens (Human)9606UniRef100_P32004
93
Q7YQJ2Q7YQJ2_PANTRL1 cell adhesion molecule (Fragment)Pan troglodytes troglodytes37011UniRef100_P32004
93
Q7YQJ1Q7YQJ1_PANTRL1 cell adhesion molecule (Fragment)Pan troglodytes verus37012UniRef100_P32004
93
Q86SE4Q86SE4_HUMANL1 cell adhesion molecule (Fragment)Homo sapiens (Human)9606UniRef100_P32004
534
A0A2K5UR74A0A2K5UR74_MACFAUncharacterized proteinMacaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)9541UniRef100_A0A2K5UR74
1,393Seed
Q7Z2J0Q7Z2J0_HUMANL1 cell adhesion molecule (Fragment)Homo sapiens (Human)9606UniRef100_A0A2K5UR74
83
Q7YQH7Q7YQH7_PANTRL1 cell adhesion molecule (Fragment)Pan troglodytes troglodytes37011UniRef100_A0A2K5UR74
83
Q7YQH6Q7YQH6_PANTRL1 cell adhesion molecule (Fragment)Pan troglodytes verus37012UniRef100_A0A2K5UR74
83
G7Q202G7Q202_MACFAUncharacterized proteinMacaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)9541UniRef100_A0A2K5UR74
334
Q7Z2I3Q7Z2I3_HUMANL1 cell adhesion molecule (Fragment)Homo sapiens (Human)9606UniRef100_A0A2K5UR74
71
Q7YQH0Q7YQH0_PANTRL1 cell adhesion molecule (Fragment)Pan troglodytes troglodytes37011UniRef100_A0A2K5UR74
71
Q7YQG9Q7YQG9_PANTRL1 cell adhesion molecule (Fragment)Pan troglodytes verus37012UniRef100_A0A2K5UR74
71
Q7Z2J8Q7Z2J8_HUMANL1 cell adhesion molecule (Fragment)Homo sapiens (Human)9606UniRef100_A0A2K5UR74
65
Q7YQJ0Q7YQJ0_PANTRL1 cell adhesion molecule (Fragment)Pan troglodytes troglodytes37011UniRef100_A0A2K5UR74
65
Q7YQI9Q7YQI9_PANTRL1 cell adhesion molecule (Fragment)Pan troglodytes verus37012UniRef100_A0A2K5UR74
65
Q7Z2H2Q7Z2H2_HUMANL1 cell adhesion molecule (Fragment)Homo sapiens (Human)9606UniRef100_A0A2K5UR74
53
Q7YQF4Q7YQF4_PANTRL1 cell adhesion molecule (Fragment)Pan troglodytes troglodytes37011UniRef100_A0A2K5UR74
53
Q7YQF3Q7YQF3_PANTRL1 cell adhesion molecule (Fragment)Pan troglodytes verus37012UniRef100_A0A2K5UR74
53
A0A2K5UR93A0A2K5UR93_MACFAUncharacterized proteinMacaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)9541UniRef100_A0A2K5UR93
1,389
A9CB47A9CB47_PAPANL1 cell adhesion molecule, isoform 1 (Predicted)Papio anubis (Olive baboon)9555UniRef100_A9CB47
1,324
A0A2I3LIQ2A0A2I3LIQ2_PAPANUncharacterized proteinPapio anubis (Olive baboon)9555UniRef100_A0A2I3LIQ2
1,320
A0A2K5NJB2A0A2K5NJB2_CERATUncharacterized proteinCercocebus atys (Sooty mangabey) (Cercocebus torquatus atys)9531UniRef100_A0A2K5NJB2
1,291
A0A2J8RLK6A0A2J8RLK6_PONABL1CAM isoform 15 (Fragment)Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii)9601UniRef100_A0A2K5NJB2
84

Sequence

Representative sequenceiLengthMass (Da)Tools
P32004

Checksumi: 5EDD764DA86C0E63

FASTA1,257140,002
        10         20         30         40         50
MVVALRYVWP LLLCSPCLLI QIPEEYEGHH VMEPPVITEQ SPRRLVVFPT
60 70 80 90 100
DDISLKCEAS GKPEVQFRWT RDGVHFKPKE ELGVTVYQSP HSGSFTITGN
110 120 130 140 150
NSNFAQRFQG IYRCFASNKL GTAMSHEIRL MAEGAPKWPK ETVKPVEVEE
160 170 180 190 200
GESVVLPCNP PPSAEPLRIY WMNSKILHIK QDERVTMGQN GNLYFANVLT
210 220 230 240 250
SDNHSDYICH AHFPGTRTII QKEPIDLRVK ATNSMIDRKP RLLFPTNSSS
260 270 280 290 300
HLVALQGQPL VLECIAEGFP TPTIKWLRPS GPMPADRVTY QNHNKTLQLL
310 320 330 340 350
KVGEEDDGEY RCLAENSLGS ARHAYYVTVE AAPYWLHKPQ SHLYGPGETA
360 370 380 390 400
RLDCQVQGRP QPEVTWRING IPVEELAKDQ KYRIQRGALI LSNVQPSDTM
410 420 430 440 450
VTQCEARNRH GLLLANAYIY VVQLPAKILT ADNQTYMAVQ GSTAYLLCKA
460 470 480 490 500
FGAPVPSVQW LDEDGTTVLQ DERFFPYANG TLGIRDLQAN DTGRYFCLAA
510 520 530 540 550
NDQNNVTIMA NLKVKDATQI TQGPRSTIEK KGSRVTFTCQ ASFDPSLQPS
560 570 580 590 600
ITWRGDGRDL QELGDSDKYF IEDGRLVIHS LDYSDQGNYS CVASTELDVV
610 620 630 640 650
ESRAQLLVVG SPGPVPRLVL SDLHLLTQSQ VRVSWSPAED HNAPIEKYDI
660 670 680 690 700
EFEDKEMAPE KWYSLGKVPG NQTSTTLKLS PYVHYTFRVT AINKYGPGEP
710 720 730 740 750
SPVSETVVTP EAAPEKNPVD VKGEGNETTN MVITWKPLRW MDWNAPQVQY
760 770 780 790 800
RVQWRPQGTR GPWQEQIVSD PFLVVSNTST FVPYEIKVQA VNSQGKGPEP
810 820 830 840 850
QVTIGYSGED YPQAIPELEG IEILNSSAVL VKWRPVDLAQ VKGHLRGYNV
860 870 880 890 900
TYWREGSQRK HSKRHIHKDH VVVPANTTSV ILSGLRPYSS YHLEVQAFNG
910 920 930 940 950
RGSGPASEFT FSTPEGVPGH PEALHLECQS NTSLLLRWQP PLSHNGVLTG
960 970 980 990 1000
YVLSYHPLDE GGKGQLSFNL RDPELRTHNL TDLSPHLRYR FQLQATTKEG
1010 1020 1030 1040 1050
PGEAIVREGG TMALSGISDF GNISATAGEN YSVVSWVPKE GQCNFRFHIL
1060 1070 1080 1090 1100
FKALGEEKGG ASLSPQYVSY NQSSYTQWDL QPDTDYEIHL FKERMFRHQM
1110 1120 1130 1140 1150
AVKTNGTGRV RLPPAGFATE GWFIGFVSAI ILLLLVLLIL CFIKRSKGGK
1160 1170 1180 1190 1200
YSVKDKEDTQ VDSEARPMKD ETFGEYRSLE SDNEEKAFGS SQPSLNGDIK
1210 1220 1230 1240 1250
PLGSDDSLAD YGGSVDVQFN EDGSFIGQYS GKKEKEAAGG NDSSGATSPI

NPAVALE
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again