Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
>UniRef90_P38277 Uncharacterized protein YBR138C n=10 Tax=Saccharomyces TaxID=4930 RepID=YBY8_YEAST MEKDQIQPRVLESVDTNSLSLLSSNTSSNMNSNTNNKLSIIASDISTGSVLSRPLTPPVV QDIENNSMLQWQFEKKEFIFDSNSTPSKQAKPLQRNSPYQGNSQSENQNQQLLNVRKRRS QLIGAKPKIPSKLYQSVSKLDLIDDKSFTSLPIAPPCNIETNEDDSGNNEYNNNKKRPRL NPVNELRVHNNKRNRYVSYGPSLDTKNYELTENTSQDIPPLVLVEDYIPYTQSKSTKKMV SISDLKSKLSKRRDNHIPLRVKNSYSEINKETNRNSFEPNSLTLIPHILRNTEENRDESN NPLDFIKEEIEISDISIPNSIENMVVNLVNIPSSNKSYDDLYLSELNVHSQLRKCVICEK ALYEISSRLLNSGYYKEIVCEQCTVRYEEAAKIFENCEFESSMDESNLSSGTFSDLENSA EPFHLSTDVPKKINRHIEDNKIDLKKEISKKKDSFSKELIERLQLQLLENDKSIKHHFNK DAMGSKSMNWFLEARRKLKWKWRINGLLPHFLRNQNSDRLNFQP

Members

Expand cluster to 50% identity.
List component clusters with 100% identity.
1 to 10 of 10  Show
Cluster membersEntry nameProtein names
Organisms
Organism IDsRelated clustersLength
Role
P38277YBY8_YEASTUncharacterized protein YBR138CSaccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)559292UniRef100_P38277
524Representative & Seed
N1P887N1P887_YEASCUncharacterized proteinSaccharomyces cerevisiae (strain CEN.PK113-7D) (Baker's yeast)889517UniRef100_P38277
524
G2W9E1G2W9E1_YEASKK7_Ybr138cpSaccharomyces cerevisiae (strain Kyokai no. 7 / NBRC 101557) (Baker's yeast)721032UniRef100_G2W9E1
524
A0A0L8VV23A0A0L8VV23_9SACHUncharacterized proteinSaccharomyces sp. 'boulardii'252598UniRef100_A0A0L8VV23
524
D3UEN2D3UEN2_YEAS8EC1118_1B15_2938pSaccharomyces cerevisiae (strain Lalvin EC1118 / Prise de mousse) (Baker's yeast)643680UniRef100_D3UEN2
524
C7GY20C7GY20_YEAS2YBR138C-like proteinSaccharomyces cerevisiae (strain JAY291) (Baker's yeast)574961UniRef100_D3UEN2
524
B3LN19B3LN19_YEAS1Uncharacterized proteinSaccharomyces cerevisiae (strain RM11-1a) (Baker's yeast)285006UniRef100_D3UEN2
524
A6ZL81A6ZL81_YEAS7Conserved proteinSaccharomyces cerevisiae (strain YJM789) (Baker's yeast)307796UniRef100_A6ZL81
524
H0GCK3H0GCK3_SACCKYBR138C-like proteinSaccharomyces cerevisiae x Saccharomyces kudriavzevii (strain VIN7) (Yeast)1095631UniRef100_H0GCK3
495
B5VE95B5VE95_YEAS6YBR138Cp-like proteinSaccharomyces cerevisiae (strain AWRI1631) (Baker's yeast)545124UniRef100_B5VE95
458

Sequence

Representative sequenceiLengthMass (Da)Tools
P38277

Checksumi: B2A57928A435E427

FASTA52460,469
        10         20         30         40         50
MEKDQIQPRV LESVDTNSLS LLSSNTSSNM NSNTNNKLSI IASDISTGSV
60 70 80 90 100
LSRPLTPPVV QDIENNSMLQ WQFEKKEFIF DSNSTPSKQA KPLQRNSPYQ
110 120 130 140 150
GNSQSENQNQ QLLNVRKRRS QLIGAKPKIP SKLYQSVSKL DLIDDKSFTS
160 170 180 190 200
LPIAPPCNIE TNEDDSGNNE YNNNKKRPRL NPVNELRVHN NKRNRYVSYG
210 220 230 240 250
PSLDTKNYEL TENTSQDIPP LVLVEDYIPY TQSKSTKKMV SISDLKSKLS
260 270 280 290 300
KRRDNHIPLR VKNSYSEINK ETNRNSFEPN SLTLIPHILR NTEENRDESN
310 320 330 340 350
NPLDFIKEEI EISDISIPNS IENMVVNLVN IPSSNKSYDD LYLSELNVHS
360 370 380 390 400
QLRKCVICEK ALYEISSRLL NSGYYKEIVC EQCTVRYEEA AKIFENCEFE
410 420 430 440 450
SSMDESNLSS GTFSDLENSA EPFHLSTDVP KKINRHIEDN KIDLKKEISK
460 470 480 490 500
KKDSFSKELI ERLQLQLLEN DKSIKHHFNK DAMGSKSMNW FLEARRKLKW
510 520
KWRINGLLPH FLRNQNSDRL NFQP
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again