Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
>UniRef90_P46100-6 Isoform 6 of Transcriptional regulator ATRX n=5 Tax=Catarrhini TaxID=9526 RepID=Isoform 6 of ATRX_HUMAN MTAEPMSESKLNTLVQKLHDFLAHSSEESEETSSPPRLAMNQNTDKISGSGSNSDMMENS KEEGTSSSEKSKSSGSSRSKRKPSIVTKYVESDDEKPLDDETVNEDASNENSENDITMQS LPKDGLHGIVSCTACGQQVNHFQKDSIYRHPSLQVLICKNCFKYYMSDDISRDSDGMDEQ CRWCAEGGNLICCDFCHNAFCKKCILRNLGRKELSTIMDENNQWYCYICHPEPLLDLVTA CNSVFENLEQLLQQNKKKIKVDSEKSNKVYEHTSRFSPKKTSSNCNGEEKKLDDSCSGSV TYSYSALIVPKEMIKKAKKLIETTANMNSSYVKFLKQATDNSEISSATKLRQLKAFKSVL ADIKKAHLALEEDLNSEFRAMDAVNKEKNTKEHKVIDAKFETKARKGEKPCALEKKDISK SEAKLSRKQVDSEHMHQNVPTEEQRTNKSTGGEHKKSDRKEEPQYEPANTSEDLDMDIVS VPSSVPEDIFENLETAMEVQSSVDHQGDGSSGTEQEVESSSVKLNISSKDNRGGADCQEV PQDKDGYKSCGLNPKLEKCGLGQENSDNEHLVENEVSLLLEESDLRRSPRVKTTPLRRPT ETNPVTSNSDEECNETVKEKQKLSVPVRKKDKRNSSDSAIDNPKPNKLPKSKQSETVDQN SDSDEMLAILKEVSRMSHSSSSDTDINEIHTNHKTLYDLKTQAGKDDKGKRKRKSSTSGS DFDTKKGKSAKSSIISKKKRQTQSESSNYDSELEKEIKSMSKIGAARTTKKRIPNTKDFD SSEDEKHSKKGMDNQGHKNLKTSQEGSSDDAERKQERETFSSAEGTVDKDTTIMELRDRL PKKQQASASTDGVDKLSGKEQSFTSLEVRKVAETKEKSKHLKTKTCKKVQDGLSDIAEKF LKKDQSDETSEDDKKQSKKGTEEKKKPSDFKKKVIKMEQQYESSSDGTEKLPEREEICHF PKGIKQIKNGTTDGEKKSKKIRDKTSKKKDELSDYAEKSTGKGDSCDSSEDKKSKNGAYG REKKRCKLLGKSSRKRQDCSSSDTEKYSMKEDGCNSSDKRLKRIELRERRNLSSKRNTKE IQSGSSSSDAEESSEDNKKKKQRTSSKKKAVIVKEKKRNSLRTSTKRKQADITSSSSSDI EDDDQNSIGEGSSDEQKIKPVTENLVLSSHTGFCQSSGDEALSKSVPVTVDDDDDDNDPE NRIAKKMLLEEIKANLSSDEDGSSDDEPEEGKKRTGKQNEENPGDEEAKNQVNSESDSDS EESKKPRYRHRLLRHKLTVSDGESGEEKKTKPKEHKEVKGRNRRKVSSEDSEDSDFQESG VSEEVSESEDEQRPRTRSAKKAELEENQRS

Members

Expand cluster to 50% identity.
List component clusters with 100% identity.
1 to 5 of 5  Show
Cluster membersEntry nameProtein names
Organisms
Organism IDsRelated clustersLength
Role
P46100-6Isoform 6 of ATRX_HUMAN6Homo sapiens (Human)9606UniRef100_P46100-6
1,350Representative
A0A2J8UT06A0A2J8UT06_PONABATRX isoform 4 (Fragment)Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii)9601UniRef100_A0A2J8UT06
1,351Seed
A0A2J8KK53A0A2J8KK53_PANTRATRX isoform 4 (Fragment)Pan troglodytes (Chimpanzee)9598UniRef100_A0A2J8KK53
1,351
A0A2J8KK28A0A2J8KK28_PANTRATRX isoform 10 (Fragment)Pan troglodytes (Chimpanzee)9598UniRef100_A0A2J8KK28
1,284
UPI00083BD238LOW QUALITY PROTEIN: transcriptional regulator ATRX-likeRhinopithecus bieti (Black snub-nosed monkey) (Pygathrix bieti)61621UniRef100_UPI00083BD238
1,225

Sequence

Representative sequenceiLengthMass (Da)Tools
P46100-6

Checksumi: A67E6A155955371A

FASTA1,350151,555
        10         20         30         40         50
MTAEPMSESK LNTLVQKLHD FLAHSSEESE ETSSPPRLAM NQNTDKISGS
60 70 80 90 100
GSNSDMMENS KEEGTSSSEK SKSSGSSRSK RKPSIVTKYV ESDDEKPLDD
110 120 130 140 150
ETVNEDASNE NSENDITMQS LPKDGLHGIV SCTACGQQVN HFQKDSIYRH
160 170 180 190 200
PSLQVLICKN CFKYYMSDDI SRDSDGMDEQ CRWCAEGGNL ICCDFCHNAF
210 220 230 240 250
CKKCILRNLG RKELSTIMDE NNQWYCYICH PEPLLDLVTA CNSVFENLEQ
260 270 280 290 300
LLQQNKKKIK VDSEKSNKVY EHTSRFSPKK TSSNCNGEEK KLDDSCSGSV
310 320 330 340 350
TYSYSALIVP KEMIKKAKKL IETTANMNSS YVKFLKQATD NSEISSATKL
360 370 380 390 400
RQLKAFKSVL ADIKKAHLAL EEDLNSEFRA MDAVNKEKNT KEHKVIDAKF
410 420 430 440 450
ETKARKGEKP CALEKKDISK SEAKLSRKQV DSEHMHQNVP TEEQRTNKST
460 470 480 490 500
GGEHKKSDRK EEPQYEPANT SEDLDMDIVS VPSSVPEDIF ENLETAMEVQ
510 520 530 540 550
SSVDHQGDGS SGTEQEVESS SVKLNISSKD NRGGADCQEV PQDKDGYKSC
560 570 580 590 600
GLNPKLEKCG LGQENSDNEH LVENEVSLLL EESDLRRSPR VKTTPLRRPT
610 620 630 640 650
ETNPVTSNSD EECNETVKEK QKLSVPVRKK DKRNSSDSAI DNPKPNKLPK
660 670 680 690 700
SKQSETVDQN SDSDEMLAIL KEVSRMSHSS SSDTDINEIH TNHKTLYDLK
710 720 730 740 750
TQAGKDDKGK RKRKSSTSGS DFDTKKGKSA KSSIISKKKR QTQSESSNYD
760 770 780 790 800
SELEKEIKSM SKIGAARTTK KRIPNTKDFD SSEDEKHSKK GMDNQGHKNL
810 820 830 840 850
KTSQEGSSDD AERKQERETF SSAEGTVDKD TTIMELRDRL PKKQQASAST
860 870 880 890 900
DGVDKLSGKE QSFTSLEVRK VAETKEKSKH LKTKTCKKVQ DGLSDIAEKF
910 920 930 940 950
LKKDQSDETS EDDKKQSKKG TEEKKKPSDF KKKVIKMEQQ YESSSDGTEK
960 970 980 990 1000
LPEREEICHF PKGIKQIKNG TTDGEKKSKK IRDKTSKKKD ELSDYAEKST
1010 1020 1030 1040 1050
GKGDSCDSSE DKKSKNGAYG REKKRCKLLG KSSRKRQDCS SSDTEKYSMK
1060 1070 1080 1090 1100
EDGCNSSDKR LKRIELRERR NLSSKRNTKE IQSGSSSSDA EESSEDNKKK
1110 1120 1130 1140 1150
KQRTSSKKKA VIVKEKKRNS LRTSTKRKQA DITSSSSSDI EDDDQNSIGE
1160 1170 1180 1190 1200
GSSDEQKIKP VTENLVLSSH TGFCQSSGDE ALSKSVPVTV DDDDDDNDPE
1210 1220 1230 1240 1250
NRIAKKMLLE EIKANLSSDE DGSSDDEPEE GKKRTGKQNE ENPGDEEAKN
1260 1270 1280 1290 1300
QVNSESDSDS EESKKPRYRH RLLRHKLTVS DGESGEEKKT KPKEHKEVKG
1310 1320 1330 1340 1350
RNRRKVSSED SEDSDFQESG VSEEVSESED EQRPRTRSAK KAELEENQRS
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again