Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
>UniRef90_P51617-3 Isoform 3 of Interleukin-1 receptor-associated kinase 1 n=28 Tax=Catarrhini TaxID=9526 RepID=Isoform 3 of IRAK1_HUMAN MAGGPGPGEPAAPGAQHFLYEVPPWVMCRFYKVMDALEPADWCQFGGWRRAAGGREARGL LAPTPDAPRPAAALIVRDQTELRLCERSGQRTASVLWPWINRNARVADLVHILTHLQLLR ARDIITAWHPPAPLPSPGTTAPRPSSIPAPAEAEAWSPRKLPSSASTFLSPAFPGSQTHS GPELGLVPSPASLWPPPPSPAPSSTKPGPESSVSLLQGARPFPFCWPLCEISRGTHNFSE ELKIGEGGFGCVYRAVMRNTVYAVKRLKENADLEWTAVKQSFLTEVEQLSRFRHPNIVDF AGYCAQNGFYCLVYGFLPNGSLEDRLHCQTQACPPLSWPQRLDILLGTARAIQFLHQDSP SLIHGDIKSSNVLLDERLTPKLGDFGLARFSRFAGSSPSQSSMVARTQTVRGTLAYLPEE YIKTGRLAVDTDTFSFGVVVLETLAGQRAVKTHGARTKYLKDLVEEEAEEAGVALRSTQS TLQAGLAADAWAAPIAMQIYKKHLGQLACCCLHRRAKRRPPMTQENSYVSSTGRAHSGAA PWQPLAAPSGASAQAAEQLQRGPNQPVESDESLGGLSAALRSWHLTPSCPLDPAPLREAG CPQGDTAGESSWGSGPGSRPTAVEGLALGSSASSSSEPPQIIINPARQKMVQKLALYEDG ALDSLQLLSSSSLPGLGLEQDRQGPEESDEFQS

Members

Expand cluster to 50% identity.
List component clusters with 100% identity.
1 to 25 of 28  Show
Cluster membersEntry nameProtein names
Organisms
Organism IDsRelated clustersLength
Role
P51617-3Isoform 3 of IRAK1_HUMAN3Homo sapiens (Human)9606UniRef100_P51617-3
693Representative
A0A1D5QFS2A0A1D5QFS2_MACMUProtein kinase domain-containing proteinMacaca mulatta (Rhesus macaque)9544UniRef100_A0A1D5QFS2
768Seed
I7GMC3I7GMC3_MACFAMacaca fascicularis brain cDNA clone: QflA-16530, similar to human interleukin-1 receptor-associated kinase 1 (IRAK1), mRNA, RefSeq: NM_001569.2Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)9541UniRef100_A0A1D5QFS2
242
H9F305H9F305_MACMUInterleukin-1 receptor-associated kinase 1 isoform 1 (Fragment)Macaca mulatta (Rhesus macaque)9544UniRef100_A0A1D5QFS2
205
G7NSK8G7NSK8_MACMUProtein kinase domain-containing protein (Fragment)Macaca mulatta (Rhesus macaque)9544UniRef100_A0A1D5QFS2
606
A0A2K6AZZ5A0A2K6AZZ5_MACNEProtein kinase domain-containing proteinMacaca nemestrina (Pig-tailed macaque)9545UniRef100_A0A2K6AZZ5
717
A0A2K6AZZ6A0A2K6AZZ6_MACNEProtein kinase domain-containing proteinMacaca nemestrina (Pig-tailed macaque)9545UniRef100_A0A2K6AZZ6
710
A0A2J8RLQ1A0A2J8RLQ1_PONABIRAK1 isoform 10Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii)9601UniRef100_A0A2J8RLQ1
708
A0A2K6AZZ1A0A2K6AZZ1_MACNEProtein kinase domain-containing proteinMacaca nemestrina (Pig-tailed macaque)9545UniRef100_A0A2K6AZZ1
708
A0A2J8INB6A0A2J8INB6_PANTRIRAK1 isoform 7Pan troglodytes (Chimpanzee)9598UniRef100_A0A2J8INB6
708
D3YTB5D3YTB5_HUMANInterleukin-1 receptor-associated kinase 1Homo sapiens (Human)9606UniRef100_D3YTB5
708
I2CWY8I2CWY8_MACMUInterleukin-1 receptor-associated kinase 1 isoform 1Macaca mulatta (Rhesus macaque)9544UniRef100_I2CWY8
708
A0A2K6RF11A0A2K6RF11_RHIROProtein kinase domain-containing proteinRhinopithecus roxellana (Golden snub-nosed monkey) (Pygathrix roxellana)61622UniRef100_A0A2K6RF11
703
K7CTV3K7CTV3_PANTRIRAK1 isoform 6Pan troglodytes (Chimpanzee)9598UniRef100_K7CTV3
682
H2PX74H2PX74_PONABIRAK1 isoform 9Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii)9601UniRef100_H2PX74
682
P51617-2Isoform 2 of IRAK1_HUMAN2, bHomo sapiens (Human)9606UniRef100_P51617-2
682
A0A2K5TQ94A0A2K5TQ94_MACFAProtein kinase domain-containing proteinMacaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)9541UniRef100_A0A2K5TQ94
662
G7Q209G7Q209_MACFAProtein kinase domain-containing protein (Fragment)Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)9541UniRef100_A0A2K5TQ94
606
A0A1D5RBH9A0A1D5RBH9_MACMUProtein kinase domain-containing proteinMacaca mulatta (Rhesus macaque)9544UniRef100_A0A1D5RBH9
646
A0A2K6B004A0A2K6B004_MACNEProtein kinase domain-containing proteinMacaca nemestrina (Pig-tailed macaque)9545UniRef100_A0A2K6B004
633
A0A096N4A8A0A096N4A8_PAPANProtein kinase domain-containing proteinPapio anubis (Olive baboon)9555UniRef100_A0A096N4A8
633
A0A2I3T515A0A2I3T515_PANTRIRAK1 isoform 3Pan troglodytes (Chimpanzee)9598UniRef100_A0A2I3T515
633
A0A2R9BZ68A0A2R9BZ68_PANPAProtein kinase domain-containing proteinPan paniscus (Pygmy chimpanzee) (Bonobo)9597UniRef100_A0A2I3T515
587
A0A2J8RLP9A0A2J8RLP9_PONABIRAK1 isoform 2Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii)9601UniRef100_A0A2J8RLP9
633
G3QDA8G3QDA8_GORGOInterleukin 1 receptor associated kinase 1Gorilla gorilla gorilla (Western lowland gorilla)9595UniRef100_G3QDA8
633

Sequence

Representative sequenceiLengthMass (Da)Tools
P51617-3

Checksumi: D744A32E997E1246

FASTA69374,560
        10         20         30         40         50
MAGGPGPGEP AAPGAQHFLY EVPPWVMCRF YKVMDALEPA DWCQFGGWRR
60 70 80 90 100
AAGGREARGL LAPTPDAPRP AAALIVRDQT ELRLCERSGQ RTASVLWPWI
110 120 130 140 150
NRNARVADLV HILTHLQLLR ARDIITAWHP PAPLPSPGTT APRPSSIPAP
160 170 180 190 200
AEAEAWSPRK LPSSASTFLS PAFPGSQTHS GPELGLVPSP ASLWPPPPSP
210 220 230 240 250
APSSTKPGPE SSVSLLQGAR PFPFCWPLCE ISRGTHNFSE ELKIGEGGFG
260 270 280 290 300
CVYRAVMRNT VYAVKRLKEN ADLEWTAVKQ SFLTEVEQLS RFRHPNIVDF
310 320 330 340 350
AGYCAQNGFY CLVYGFLPNG SLEDRLHCQT QACPPLSWPQ RLDILLGTAR
360 370 380 390 400
AIQFLHQDSP SLIHGDIKSS NVLLDERLTP KLGDFGLARF SRFAGSSPSQ
410 420 430 440 450
SSMVARTQTV RGTLAYLPEE YIKTGRLAVD TDTFSFGVVV LETLAGQRAV
460 470 480 490 500
KTHGARTKYL KDLVEEEAEE AGVALRSTQS TLQAGLAADA WAAPIAMQIY
510 520 530 540 550
KKHLGQLACC CLHRRAKRRP PMTQENSYVS STGRAHSGAA PWQPLAAPSG
560 570 580 590 600
ASAQAAEQLQ RGPNQPVESD ESLGGLSAAL RSWHLTPSCP LDPAPLREAG
610 620 630 640 650
CPQGDTAGES SWGSGPGSRP TAVEGLALGS SASSSSEPPQ IIINPARQKM
660 670 680 690
VQKLALYEDG ALDSLQLLSS SSLPGLGLEQ DRQGPEESDE FQS
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again