Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
>UniRef90_P51617-3 Isoform 3 of Interleukin-1 receptor-associated kinase 1 n=29 Tax=Catarrhini TaxID=9526 RepID=Isoform 3 of IRAK1_HUMAN MAGGPGPGEPAAPGAQHFLYEVPPWVMCRFYKVMDALEPADWCQFGGWRRAAGGREARGL LAPTPDAPRPAAALIVRDQTELRLCERSGQRTASVLWPWINRNARVADLVHILTHLQLLR ARDIITAWHPPAPLPSPGTTAPRPSSIPAPAEAEAWSPRKLPSSASTFLSPAFPGSQTHS GPELGLVPSPASLWPPPPSPAPSSTKPGPESSVSLLQGARPFPFCWPLCEISRGTHNFSE ELKIGEGGFGCVYRAVMRNTVYAVKRLKENADLEWTAVKQSFLTEVEQLSRFRHPNIVDF AGYCAQNGFYCLVYGFLPNGSLEDRLHCQTQACPPLSWPQRLDILLGTARAIQFLHQDSP SLIHGDIKSSNVLLDERLTPKLGDFGLARFSRFAGSSPSQSSMVARTQTVRGTLAYLPEE YIKTGRLAVDTDTFSFGVVVLETLAGQRAVKTHGARTKYLKDLVEEEAEEAGVALRSTQS TLQAGLAADAWAAPIAMQIYKKHLGQLACCCLHRRAKRRPPMTQENSYVSSTGRAHSGAA PWQPLAAPSGASAQAAEQLQRGPNQPVESDESLGGLSAALRSWHLTPSCPLDPAPLREAG CPQGDTAGESSWGSGPGSRPTAVEGLALGSSASSSSEPPQIIINPARQKMVQKLALYEDG ALDSLQLLSSSSLPGLGLEQDRQGPEESDEFQS

Members

Expand cluster to 50% identity.
List component clusters with 100% identity.
1 to 3 of 3  Show
Cluster membersEntry nameProtein names
Organisms
Organism IDsRelated clustersLength
Role
P51617-3Isoform 3 of IRAK1_HUMAN3Homo sapiens (Human)9606UniRef100_P51617-3
693Representative
P51617-2Isoform 2 of IRAK1_HUMAN2, bHomo sapiens (Human)9606UniRef100_P51617-2
682
P51617-4Isoform 4 of IRAK1_HUMAN4Homo sapiens (Human)9606UniRef100_P51617-4
633

Sequence

Representative sequenceiLengthMass (Da)Tools
P51617-3

Checksumi: D744A32E997E1246

FASTA69374,560
        10         20         30         40         50
MAGGPGPGEP AAPGAQHFLY EVPPWVMCRF YKVMDALEPA DWCQFGGWRR
60 70 80 90 100
AAGGREARGL LAPTPDAPRP AAALIVRDQT ELRLCERSGQ RTASVLWPWI
110 120 130 140 150
NRNARVADLV HILTHLQLLR ARDIITAWHP PAPLPSPGTT APRPSSIPAP
160 170 180 190 200
AEAEAWSPRK LPSSASTFLS PAFPGSQTHS GPELGLVPSP ASLWPPPPSP
210 220 230 240 250
APSSTKPGPE SSVSLLQGAR PFPFCWPLCE ISRGTHNFSE ELKIGEGGFG
260 270 280 290 300
CVYRAVMRNT VYAVKRLKEN ADLEWTAVKQ SFLTEVEQLS RFRHPNIVDF
310 320 330 340 350
AGYCAQNGFY CLVYGFLPNG SLEDRLHCQT QACPPLSWPQ RLDILLGTAR
360 370 380 390 400
AIQFLHQDSP SLIHGDIKSS NVLLDERLTP KLGDFGLARF SRFAGSSPSQ
410 420 430 440 450
SSMVARTQTV RGTLAYLPEE YIKTGRLAVD TDTFSFGVVV LETLAGQRAV
460 470 480 490 500
KTHGARTKYL KDLVEEEAEE AGVALRSTQS TLQAGLAADA WAAPIAMQIY
510 520 530 540 550
KKHLGQLACC CLHRRAKRRP PMTQENSYVS STGRAHSGAA PWQPLAAPSG
560 570 580 590 600
ASAQAAEQLQ RGPNQPVESD ESLGGLSAAL RSWHLTPSCP LDPAPLREAG
610 620 630 640 650
CPQGDTAGES SWGSGPGSRP TAVEGLALGS SASSSSEPPQ IIINPARQKM
660 670 680 690
VQKLALYEDG ALDSLQLLSS SSLPGLGLEQ DRQGPEESDE FQS
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again