Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
>UniRef90_P52151 Adenylosuccinate synthetase n=12 RepID=PURA_ACIFR MNQNVVIIGTQWGDEGKGKIVDWLTERCQAVVRFQGGHNAGHTLVIGARKTILHLIPSGI LRADVSCFIGNGVVLDPLALFSELDELRPVVPDAQERLFISDACPLILPYHKSLDRAREQ AMGAAKIGTTGRGIGPAYEDKVRRRALRVADLFHRERFAAKLAEALDYHNFVLQHYFKRE PENFHAILEQYLELADGLAPMVVDVSVRLARLQAEGARILFEGAQGTLLDVDHGTYPFVT SSNTVAGGASAGSGVGPADLGYVLGITKAYTTRVGAGPFPTELFDETGVFLAERGAEVGA TTGRARRCGWFDAVALRAACRVNGVTGLCITKLDVLDGLAEIRVAVGYRVNGVVQEELPG GAEALAACEPIYESFPGWSESTAGVRHWADLPQAARCYLEAIAERAERPLAIISTGPDRD DTILRTEIL

Members

Expand cluster to 50% identity.
List component clusters with 100% identity.
1 to 12 of 12  Show
Cluster membersEntry nameProtein names
Organisms
Organism IDsRelated clustersLength
Role
P52151PURA_ACIFRAdenylosuccinate synthetaseAcidithiobacillus ferrooxidans (Thiobacillus ferrooxidans)920UniRef100_P52151
429Representative
A0A2W1K4V2A0A2W1K4V2_ACIFRAdenylosuccinate synthetaseAcidithiobacillus ferrooxidans (Thiobacillus ferrooxidans)920UniRef100_A0A2W1K4V2
431Seed
F8XN80F8XN80_9PROTAdenylosuccinate synthetaseAcidithiobacillus sp. GGI-221872330UniRef100_A0A2W1K4V2
431
B7JBZ1B7JBZ1_ACIF2Adenylosuccinate synthetaseAcidithiobacillus ferrooxidans (strain ATCC 23270 / DSM 14882 / CIP 104768 / NCIMB 8455) (Ferrobacillus ferrooxidans (strain ATCC 23270))243159UniRef100_A0A2W1K4V2
431
A0A365YL12A0A365YL12_ACIFRAdenylosuccinate synthetaseAcidithiobacillus ferrooxidans (Thiobacillus ferrooxidans)920UniRef100_A0A365YL12
431
A0A2Z6ILI1A0A2Z6ILI1_9PROTAdenylosuccinate synthetaseAcidithiobacillus ferridurans1232575UniRef100_A0A365YL12
431
A0A060UN98A0A060UN98_9PROTAdenylosuccinate synthetaseAcidithiobacillus ferrivorans160808UniRef100_A0A060UN98
431
A0A1B9BUT0A0A1B9BUT0_9PROTAdenylosuccinate synthetaseAcidithiobacillus ferrivorans160808UniRef100_A0A060UN98
429
G0JR43G0JR43_9PROTAdenylosuccinate synthetaseAcidithiobacillus ferrivorans SS3743299UniRef100_A0A060UN98
429
E6QGL8E6QGL8_9ZZZZAdenylosuccinate synthetase (IMP--aspartate ligase) (AdSS) (AMPSase)mine drainage metagenome410659UniRef100_E6QGL8
431
A0A179B9F2A0A179B9F2_ACIFRAdenylosuccinate synthetaseAcidithiobacillus ferrooxidans (Thiobacillus ferrooxidans)920UniRef100_A0A179B9F2
429
A0A257TAM9A0A257TAM9_9PROTAdenylosuccinate synthetaseAcidithiobacillus ferrivorans160808UniRef100_A0A179B9F2
429

Sequence

Representative sequenceiLengthMass (Da)Tools
P52151

Checksumi: C5B2F39C3E105719

FASTA42946,356
        10         20         30         40         50
MNQNVVIIGT QWGDEGKGKI VDWLTERCQA VVRFQGGHNA GHTLVIGARK
60 70 80 90 100
TILHLIPSGI LRADVSCFIG NGVVLDPLAL FSELDELRPV VPDAQERLFI
110 120 130 140 150
SDACPLILPY HKSLDRAREQ AMGAAKIGTT GRGIGPAYED KVRRRALRVA
160 170 180 190 200
DLFHRERFAA KLAEALDYHN FVLQHYFKRE PENFHAILEQ YLELADGLAP
210 220 230 240 250
MVVDVSVRLA RLQAEGARIL FEGAQGTLLD VDHGTYPFVT SSNTVAGGAS
260 270 280 290 300
AGSGVGPADL GYVLGITKAY TTRVGAGPFP TELFDETGVF LAERGAEVGA
310 320 330 340 350
TTGRARRCGW FDAVALRAAC RVNGVTGLCI TKLDVLDGLA EIRVAVGYRV
360 370 380 390 400
NGVVQEELPG GAEALAACEP IYESFPGWSE STAGVRHWAD LPQAARCYLE
410 420
AIAERAERPL AIISTGPDRD DTILRTEIL
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again