Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
>UniRef90_P55201-3 Isoform 3 of Peregrin n=265 Tax=Amniota TaxID=32524 RepID=Isoform 3 of BRPF1_HUMAN MGVDFDVKTFCHNLRATKPPYECPVETCRKVYKSYSGIEYHLYHYDHDNPPPPQQTPLRK HKKKGRQSRPANKQSPSPSEVSQSPGREVMSYAQAQRMVEVDLHGRVHRISIFDNLDVVS EDEEAPEEAPENGSNKENTETPAATPKSGKHKNKEKRKDSNHHHHHNVSASTTPKLPEVV YRELEQDTPDAPPRPTSYYRYIEKSAEELDEEVEYDMDEEDYIWLDIMNERRKTEGVSPI PQEIFEYLMDRLEKESYFESHNKGDPNALVDEDAVCCICNDGECQNSNVILFCDMCNLAV HQECYGVPYIPEGQWLCRRCLQSPSRAVDCALCPNKGGAFKQTDDGRWAHVVCALWIPEV CFANTVFLEPIDSIEHIPPARWKLTCYICKQRGSGACIQCHKANCYTAFHVTCAQQAGLY MKMEPVRETGANGTSFSVRKTAYCDIHTPPGSARRLPALSHSEGEEDEDEEEDEGKGWSS EKVKKAKAKSRIKMKKARKILAEKRAAAPVVSVPCIPPHRLSKITNRLTIQRKSQFMQRL HSYWTLKRQSRNGVPLLRRLQTHLQSQRNCDQVGRDSEDKNWALKEQLKSWQRLRHDLER ARLLVELIRKREKLKRETIKVQQIAMEMQLTPFLILLRKTLEQLQEKDTGNIFSEPVPLS EVPDYLDHIKKPMDFFTMKQNLEAYRYLNFDDFEEDFNLIVSNCLKYNAKDTIFYRAAVR LREQGGAVLRQARRQAEKMGIDFETGMHIPHSLAGDEATHHTEDAEEERLVLLENQKHLP VEEQLKLLLERLDEVNASKQSVGRSRRAKMIKKEMTALRRKLAHQRETGRDGPERHGPSS RGSLTPHPAACDKDGQTDSAAEESSSQETSKGLGPNMSSTPAHEVGRRTSVLFSKKNPKT AGPPKRPGRPPKNRESQMTPSHGGSPVGPPQLPIMSSLRQRKRGRSPRPSSSSDSDSDKS TEDPPMDLPANGFSGGNQPVKKSFLVYRNDCSLPRSSSDSESSSSSSSSAASDRTSTTPS KQGRGKPSFSRGTFPEDSSEDTSGTENEAYSVGTGRGVGHSMVRKSLGRGAGWLSEDEDS PLDALDLVWAKCRGYPSYPALIIDPKMPREGMFHHGVPIPVPPLEVLKLGEQMTQEAREH LYLVLFFDNKRTWQWLPRTKLVPLGVNQDLDKEKMLEGRKSNIRKSVQIAYHRALQHRSK VQGEQSSETSDSD

Members

Expand cluster to 50% identity.
List component clusters with 100% identity.
1 to 25 of 265  Show
Cluster membersEntry nameProtein names
Organisms
Organism IDsRelated clustersLength
Role
P55201-3Isoform 3 of BRPF1_HUMAN3Homo sapiens (Human)9606UniRef100_P55201-3
1,213Representative
A0A480Y4Q2A0A480Y4Q2_PIGPeregrin isoform X5Sus scrofa (Pig)9823UniRef100_A0A480Y4Q2
1,287Seed
A0A2Y9IZZ0A0A2Y9IZZ0_ENHLUperegrin isoform X1Enhydra lutris kenyoni391180UniRef100_A0A2Y9IZZ0
1,254
M1EK84M1EK84_MUSPFBromodomain and PHD finger containing, 1 (Fragment)Mustela putorius furo (European domestic ferret) (Mustela furo)9669UniRef100_A0A2Y9IZZ0
278
A0A452R6J0A0A452R6J0_URSAMBromodomain and PHD finger containing 1Ursus americanus (American black bear) (Euarctos americanus)9643UniRef100_A0A452R6J0
1,253
A0A3Q0CDQ3A0A3Q0CDQ3_MESAUperegrin isoform X1Mesocricetus auratus (Golden hamster)10036UniRef100_A0A3Q0CDQ3
1,253
A0A2Y9IZ67A0A2Y9IZ67_ENHLUperegrin isoform X2Enhydra lutris kenyoni391180UniRef100_A0A2Y9IZ67
1,253
A0A212C9Q9A0A212C9Q9_CEREHBRPF1Cervus elaphus hippelaphus (European red deer)46360UniRef100_A0A212C9Q9
1,251
A0A2Y9IZ79A0A2Y9IZ79_ENHLUperegrin isoform X3Enhydra lutris kenyoni391180UniRef100_A0A2Y9IZ79
1,248
A0A2U3ZK75A0A2U3ZK75_ODOROperegrin isoform X1Odobenus rosmarus divergens (Pacific walrus)9708UniRef100_A0A2U3ZK75
1,248
A0A3Q7V7E2A0A3Q7V7E2_URSARperegrin isoform X1Ursus arctos horribilis116960UniRef100_A0A3Q7V7E2
1,248
A0A2Y9HG68A0A2Y9HG68_NEOSCperegrin isoform X1Neomonachus schauinslandi (Hawaiian monk seal) (Monachus schauinslandi)29088UniRef100_A0A2Y9HG68
1,248
A0A3Q7QFY6A0A3Q7QFY6_CALURperegrin isoform X1Callorhinus ursinus (Northern fur seal)34884UniRef100_A0A3Q7QFY6
1,248
A0A3Q7U446A0A3Q7U446_VULVUperegrin isoform X1Vulpes vulpes (Red fox)9627UniRef100_A0A3Q7U446
1,248
A0A341D2W6A0A341D2W6_9CETAperegrin isoform X2Neophocaena asiaeorientalis asiaeorientalis (Yangtze finless porpoise)1706337UniRef100_A0A341D2W6
1,247
A0A455AGR0A0A455AGR0_PHYMCperegrin isoform X1Physeter macrocephalus (Sperm whale) (Physeter catodon)9755UniRef100_A0A455AGR0
1,247
A0A2F0B5U4A0A2F0B5U4_ESCROPeregrin (Fragment)Eschrichtius robustus (California gray whale) (Eschrichtius gibbosus)9764UniRef100_A0A455AGR0
671
G1MD00G1MD00_AILMEUncharacterized proteinAiluropoda melanoleuca (Giant panda)9646UniRef100_G1MD00
1,247
A0A3Q7UHI4A0A3Q7UHI4_VULVUperegrin isoform X2Vulpes vulpes (Red fox)9627UniRef100_A0A3Q7UHI4
1,247
G1PLP6G1PLP6_MYOLUUncharacterized proteinMyotis lucifugus (Little brown bat)59463UniRef100_G1PLP6
1,247
W5P8K3W5P8K3_SHEEPUncharacterized proteinOvis aries (Sheep)9940UniRef100_W5P8K3
1,247
A0A2U3VDR0A0A2U3VDR0_ODOROperegrin isoform X2Odobenus rosmarus divergens (Pacific walrus)9708UniRef100_A0A2U3VDR0
1,247
A0A2Y9MDT6A0A2Y9MDT6_DELLEperegrin isoform X1Delphinapterus leucas (Beluga whale)9749UniRef100_A0A2Y9MDT6
1,247
A0A1U8BI95A0A1U8BI95_MESAUperegrin isoform X3Mesocricetus auratus (Golden hamster)10036UniRef100_A0A1U8BI95
1,247
A0A2Y9J2J9A0A2Y9J2J9_ENHLUperegrin isoform X4Enhydra lutris kenyoni391180UniRef100_A0A2Y9J2J9
1,247

Sequence

Representative sequenceiLengthMass (Da)Tools
P55201-3

Checksumi: C92CF66AB4788CB6

FASTA1,213137,427
        10         20         30         40         50
MGVDFDVKTF CHNLRATKPP YECPVETCRK VYKSYSGIEY HLYHYDHDNP
60 70 80 90 100
PPPQQTPLRK HKKKGRQSRP ANKQSPSPSE VSQSPGREVM SYAQAQRMVE
110 120 130 140 150
VDLHGRVHRI SIFDNLDVVS EDEEAPEEAP ENGSNKENTE TPAATPKSGK
160 170 180 190 200
HKNKEKRKDS NHHHHHNVSA STTPKLPEVV YRELEQDTPD APPRPTSYYR
210 220 230 240 250
YIEKSAEELD EEVEYDMDEE DYIWLDIMNE RRKTEGVSPI PQEIFEYLMD
260 270 280 290 300
RLEKESYFES HNKGDPNALV DEDAVCCICN DGECQNSNVI LFCDMCNLAV
310 320 330 340 350
HQECYGVPYI PEGQWLCRRC LQSPSRAVDC ALCPNKGGAF KQTDDGRWAH
360 370 380 390 400
VVCALWIPEV CFANTVFLEP IDSIEHIPPA RWKLTCYICK QRGSGACIQC
410 420 430 440 450
HKANCYTAFH VTCAQQAGLY MKMEPVRETG ANGTSFSVRK TAYCDIHTPP
460 470 480 490 500
GSARRLPALS HSEGEEDEDE EEDEGKGWSS EKVKKAKAKS RIKMKKARKI
510 520 530 540 550
LAEKRAAAPV VSVPCIPPHR LSKITNRLTI QRKSQFMQRL HSYWTLKRQS
560 570 580 590 600
RNGVPLLRRL QTHLQSQRNC DQVGRDSEDK NWALKEQLKS WQRLRHDLER
610 620 630 640 650
ARLLVELIRK REKLKRETIK VQQIAMEMQL TPFLILLRKT LEQLQEKDTG
660 670 680 690 700
NIFSEPVPLS EVPDYLDHIK KPMDFFTMKQ NLEAYRYLNF DDFEEDFNLI
710 720 730 740 750
VSNCLKYNAK DTIFYRAAVR LREQGGAVLR QARRQAEKMG IDFETGMHIP
760 770 780 790 800
HSLAGDEATH HTEDAEEERL VLLENQKHLP VEEQLKLLLE RLDEVNASKQ
810 820 830 840 850
SVGRSRRAKM IKKEMTALRR KLAHQRETGR DGPERHGPSS RGSLTPHPAA
860 870 880 890 900
CDKDGQTDSA AEESSSQETS KGLGPNMSST PAHEVGRRTS VLFSKKNPKT
910 920 930 940 950
AGPPKRPGRP PKNRESQMTP SHGGSPVGPP QLPIMSSLRQ RKRGRSPRPS
960 970 980 990 1000
SSSDSDSDKS TEDPPMDLPA NGFSGGNQPV KKSFLVYRND CSLPRSSSDS
1010 1020 1030 1040 1050
ESSSSSSSSA ASDRTSTTPS KQGRGKPSFS RGTFPEDSSE DTSGTENEAY
1060 1070 1080 1090 1100
SVGTGRGVGH SMVRKSLGRG AGWLSEDEDS PLDALDLVWA KCRGYPSYPA
1110 1120 1130 1140 1150
LIIDPKMPRE GMFHHGVPIP VPPLEVLKLG EQMTQEAREH LYLVLFFDNK
1160 1170 1180 1190 1200
RTWQWLPRTK LVPLGVNQDL DKEKMLEGRK SNIRKSVQIA YHRALQHRSK
1210
VQGEQSSETS DSD
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again