Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
>UniRef90_P78552-2 Isoform 2 of Interleukin-13 receptor subunit alpha-1 n=4 Tax=Catarrhini TaxID=9526 RepID=Isoform 2 of I13R1_HUMAN MEWPARLCGLWALLLCAGGGGGGGGAAPTETQPPVTNLSVSVENLCTVIWTWNPPEGASS NCSLWYFSHFGDKQDKKIAPETRRSIEVPLNERICLQVGSQCSTNESEKPSILVEKCISP PEGDPESAVTELQCIWHNLSYMKCSWLPGRNTSPDTNYTLYYWHRSLEKIHQCENIFREG QYFGCSFDLTKVKDSSFEQHSVQIMVKDNAGKIKPSFNIVPLTSRVKPDPPHIKNLSFHN DDLYVQWENPQNFISRCLFYEVEVNNSQTETHNVFYVRF

Members

Expand cluster to 50% identity.
List component clusters with 100% identity.
1 to 4 of 4  Show
Cluster membersEntry nameProtein names
Organisms
Organism IDsRelated clustersLength
Role
P78552-2Isoform 2 of I13R1_HUMAN2Homo sapiens (Human)9606UniRef100_P78552-2
279Representative
A0A2J8J402A0A2J8J402_PANTRIL13RA1 isoform 2Pan troglodytes (Chimpanzee)9598UniRef100_A0A2J8J402
281Seed
A0A096NPU0A0A096NPU0_PAPANUncharacterized proteinPapio anubis (Olive baboon)9555UniRef100_A0A096NPU0
277
A0A2J8WWB0A0A2J8WWB0_PONABIL13RA1 isoform 2Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii)9601UniRef100_A0A2J8WWB0
277

Sequence

Representative sequenceiLengthMass (Da)Tools
P78552-2

Checksumi: E74141FE9F8E9EBB

FASTA27931,659
        10         20         30         40         50
MEWPARLCGL WALLLCAGGG GGGGGAAPTE TQPPVTNLSV SVENLCTVIW
60 70 80 90 100
TWNPPEGASS NCSLWYFSHF GDKQDKKIAP ETRRSIEVPL NERICLQVGS
110 120 130 140 150
QCSTNESEKP SILVEKCISP PEGDPESAVT ELQCIWHNLS YMKCSWLPGR
160 170 180 190 200
NTSPDTNYTL YYWHRSLEKI HQCENIFREG QYFGCSFDLT KVKDSSFEQH
210 220 230 240 250
SVQIMVKDNA GKIKPSFNIV PLTSRVKPDP PHIKNLSFHN DDLYVQWENP
260 270
QNFISRCLFY EVEVNNSQTE THNVFYVRF
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again