Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
>UniRef90_P97275 Alkyldihydroxyacetonephosphate synthase, peroxisomal n=176 Tax=Eutheria TaxID=9347 RepID=ADAS_CAVPO MAEAAAAAAAAAAAGETSASSGSAAERDPDQDRAGRRLRVLSGHLLGRPQEALSTNECKA RRAASAATAAPTATPAAPESGIIPKKRQELMKWNGWGYNDSKFFLNKKGQLELTGKRYPL SGVALPTFKDWIQNTFGINLDHKTTSKASLNPSDTPPSIVNEDFLHELKKTNISYSQEAD DRVFRAHGHCLHEIFLLREGMFERIPDIVLWPTCHDDVVKIVNLACKYNLCIIPIGGGTS VSYGLMCPADETRTIISLDTSQMNRILWVDENNLTAHVEAGITGQELERQLKESGYCTGH EPDSLEFSTVGGWISTRASGMKKNIYGNIEDLVVHMKVVTPRGVIEKSCQGPRMSTGPDI HHFIMGSEGTLGVITEATIKIRPTPEYQKYGSVAFPNFEQGVACLREIAKQRCAPASIRL MDNQQFQFGHALKPQVSSIFTSFLDGLKKFYITKFKGFDPNQLSVATLLFEGDREKVLQH EKQVYDIAAKFGGLAAGEDNGQRGYLLTYVIAYMRDLGLEYYIIGESFETSAPWDRVVDL CRNVKERIRRECKEKGVQFPPLSTCRVTQTYDAGACIYFYFAFNYRGISDPLAVFEQTEA AAREEILANGGSLSHHHGVGKLRKQWLKESISDVGFGMLKSVKDYVDPTNIFGNRNLL

Members

Expand cluster to 50% identity.
List component clusters with 100% identity.
1 to 25 of 176  Show
Cluster membersEntry nameProtein names
Organisms
Organism IDsRelated clustersLength
Role
P97275ADAS_CAVPOAlkyldihydroxyacetonephosphate synthase, peroxisomalCavia porcellus (Guinea pig)10141UniRef100_P97275
658Representative
Q8C0I1ADAS_MOUSEAlkyldihydroxyacetonephosphate synthase, peroxisomalMus musculus (Mouse)10090UniRef100_Q8C0I1
645
Q9EQR2ADAS_RATAlkyldihydroxyacetonephosphate synthase, peroxisomalRattus norvegicus (Rat)10116UniRef100_Q9EQR2
644
M3XEX9M3XEX9_FELCAAlkylglycerone-phosphate synthaseFelis catus (Cat) (Felis silvestris catus)9685UniRef100_M3XEX9
727Seed
M3WXB1M3WXB1_FELCAAlkylglycerone-phosphate synthaseFelis catus (Cat) (Felis silvestris catus)9685UniRef100_M3WXB1
715
A0A3Q2HGD7A0A3Q2HGD7_HORSEAlkylglycerone-phosphate synthaseEquus caballus (Horse)9796UniRef100_A0A3Q2HGD7
689
K9K9Y2K9K9Y2_HORSEAlkylglycerone-phosphate synthase (Fragment)Equus caballus (Horse)9796UniRef100_A0A3Q2HGD7
463
A0A1S2ZUI5A0A1S2ZUI5_ERIEUAlkylglycerone-phosphate synthaseErinaceus europaeus (Western European hedgehog)9365UniRef100_A0A1S2ZUI5
688
A0A2Y9SH20A0A2Y9SH20_PHYMCAlkylglycerone-phosphate synthasePhyseter macrocephalus (Sperm whale) (Physeter catodon)9755UniRef100_A0A2Y9SH20
685
A0A4W2D6Z9A0A4W2D6Z9_BOBOXAlkylglycerone-phosphate synthaseBos indicus x Bos taurus (Hybrid cattle)30522UniRef100_A0A4W2D6Z9
684
A0A2U4ABP9A0A2U4ABP9_TURTRAlkylglycerone-phosphate synthaseTursiops truncatus (Atlantic bottle-nosed dolphin) (Delphinus truncatus)9739UniRef100_A0A2U4ABP9
683
A0A2Y9MV92A0A2Y9MV92_DELLEAlkylglycerone-phosphate synthaseDelphinapterus leucas (Beluga whale)9749UniRef100_A0A2Y9MV92
683
K9IMB3K9IMB3_DESROAlkylglycerone-phosphate synthaseDesmodus rotundus (Vampire bat)9430UniRef100_K9IMB3
682
A0A340WU87A0A340WU87_LIPVEAlkylglycerone-phosphate synthaseLipotes vexillifer (Yangtze river dolphin)118797UniRef100_A0A340WU87
682
U3KPJ6U3KPJ6_RABITAlkylglycerone-phosphate synthaseOryctolagus cuniculus (Rabbit)9986UniRef100_U3KPJ6
680
A0A2U3W6J0A0A2U3W6J0_ODOROAlkylglycerone-phosphate synthaseOdobenus rosmarus divergens (Pacific walrus)9708UniRef100_A0A2U3W6J0
680
A0A2K6E0N8A0A2K6E0N8_MACNEAlkylglycerone-phosphate synthaseMacaca nemestrina (Pig-tailed macaque)9545UniRef100_A0A2K6E0N8
679
A0A2K5PEN9A0A2K5PEN9_CEBCAAlkylglycerone-phosphate synthaseCebus capucinus imitator1737458UniRef100_A0A2K5PEN9
678
A0A2Y9DJ26A0A2Y9DJ26_TRIMAAlkylglycerone-phosphate synthaseTrichechus manatus latirostris (Florida manatee)127582UniRef100_A0A2Y9DJ26
678
A0A250Y449A0A250Y449_CASCNAlkylglycerone-phosphate synthaseCastor canadensis (American beaver)51338UniRef100_A0A250Y449
678
F7IJC2F7IJC2_CALJAAlkylglycerone-phosphate synthaseCallithrix jacchus (White-tufted-ear marmoset)9483UniRef100_F7IJC2
678
U3BV94U3BV94_CALJAAlkylglycerone-phosphate synthaseCallithrix jacchus (White-tufted-ear marmoset)9483UniRef100_F7IJC2
652
A0A4X1UI61A0A4X1UI61_PIGAlkylglycerone-phosphate synthaseSus scrofa (Pig)9823UniRef100_A0A4X1UI61
676
I3MJI8I3MJI8_ICTTRAlkylglycerone-phosphate synthaseIctidomys tridecemlineatus (Thirteen-lined ground squirrel) (Spermophilus tridecemlineatus)43179UniRef100_I3MJI8
674
A0A4W2EUE0A0A4W2EUE0_BOBOXAlkylglycerone-phosphate synthaseBos indicus x Bos taurus (Hybrid cattle)30522UniRef100_A0A4W2EUE0
673

Sequence

Representative sequenceiLengthMass (Da)Tools
P97275

Checksumi: B6272EB407EBB5F1

FASTA65872,846
        10         20         30         40         50
MAEAAAAAAA AAAAGETSAS SGSAAERDPD QDRAGRRLRV LSGHLLGRPQ
60 70 80 90 100
EALSTNECKA RRAASAATAA PTATPAAPES GIIPKKRQEL MKWNGWGYND
110 120 130 140 150
SKFFLNKKGQ LELTGKRYPL SGVALPTFKD WIQNTFGINL DHKTTSKASL
160 170 180 190 200
NPSDTPPSIV NEDFLHELKK TNISYSQEAD DRVFRAHGHC LHEIFLLREG
210 220 230 240 250
MFERIPDIVL WPTCHDDVVK IVNLACKYNL CIIPIGGGTS VSYGLMCPAD
260 270 280 290 300
ETRTIISLDT SQMNRILWVD ENNLTAHVEA GITGQELERQ LKESGYCTGH
310 320 330 340 350
EPDSLEFSTV GGWISTRASG MKKNIYGNIE DLVVHMKVVT PRGVIEKSCQ
360 370 380 390 400
GPRMSTGPDI HHFIMGSEGT LGVITEATIK IRPTPEYQKY GSVAFPNFEQ
410 420 430 440 450
GVACLREIAK QRCAPASIRL MDNQQFQFGH ALKPQVSSIF TSFLDGLKKF
460 470 480 490 500
YITKFKGFDP NQLSVATLLF EGDREKVLQH EKQVYDIAAK FGGLAAGEDN
510 520 530 540 550
GQRGYLLTYV IAYMRDLGLE YYIIGESFET SAPWDRVVDL CRNVKERIRR
560 570 580 590 600
ECKEKGVQFP PLSTCRVTQT YDAGACIYFY FAFNYRGISD PLAVFEQTEA
610 620 630 640 650
AAREEILANG GSLSHHHGVG KLRKQWLKES ISDVGFGMLK SVKDYVDPTN

IFGNRNLL
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again