Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
>UniRef90_P97500 Myelin transcription factor 1-like protein n=14 Tax=Rodentia TaxID=9989 RepID=MYT1L_MOUSE MDVDSEEKRHRTRSKGVRVPVEPAIQELFSCPTPGCDGSGHVSGKYARHRSVYGCPLAKK RKTQDKQPQEPAPKRKPFAVKADSSSVDECYESDGTEDMDDKEEDDDEEFSEDNDEQGDD DDEDEVDREDEEEIEEEDDEEDDDDEDGDDVEEEEEDDDEEEEEEEEEEENEDHQMSCTR IMQDTDKDDNNNDEYDNYDELVAKSLLNLGKIAEDAAYRARTESEMNSNTSNSLEDDSDK NENLGRKSELSLDLDSDVVRETVDSLKLLAQGHGVVLSENISDRSYAEGMSQQDSRNMNY VMLGKPMNNGLMEKMVEESDEEVCLSSLECLRNQCFDLARKLSETNPQDRSQPPNMSVRQ HVRQEDDFPGRTPDRSYSDMMNLMRLEEQLSPRSRTFSSCAKEDGCHERDDDTTSVNSDR SEEVFDMTKGNLTLLEKAIALETERAKAMREKMAMDAGRRDNLRSYEDQSPRQLAGEDRK SKSSDSHVKKPYYGKDPSRTEKRESKCPTPGCDGTGHVTGLYPHHRSLSGCPHKDRVPPE ILAMHENVLKCPTPGCTGRGHVNSNRNSHRSLSGCPIAAAEKLAKAQEKHQSCDVSKSNQ ASDRVLRPMCFVKQLEIPQYGYRNNVPTTTPRSNLAKELEKYSKTSFEYNSYDNHTYGKR AIAPKVQTRDISPKGYDDAKRYCKNASPSSSTTSSYAPSSSSNLSCGGGSSASSTCSKSS FDYTHDMEAAHMAATAILNLSTRCREMPQNLSTKPQDLCTARNPDMEVDENGTLDLSMNK QRPRDSCCPVLTPLEPMSPQQQAVMSSRCFQLSEGDCWDLPVDYTKMKPRRVDEDEPKEI TPEDLDPFQEALEERRYPGEVTIPSPKPKYPQCKESKKDLITLSGCPLADKSIRSMLATS SQELKCPTPGCDGSGHITGNYASHRSLSGCPRAKKSGIRIAQSKEDKEDQEPIRCPVPGC DGQGHITGKYASHRSASGCPLAAKRQKDGYLNGSQFSWKSVKTEGMSCPTPGCDGSGHVS GSFLTHRSLSGCPRATSAMKKAKLSGEQMLTIKQRASNGIENDEEIKQLDEEIKELNESN SQMEADMIKLRTQITTMESNLKTIEEENKVIEQQNESLLHELANLSQSLIHSLANIQLPH MDPINEQNFDAYVTTLTEMYTNQDRYQSPENKALLENIKQAVRGIQV

Members

Expand cluster to 50% identity.
List component clusters with 100% identity.
1 to 14 of 14  Show
Cluster membersEntry nameProtein names
Organisms
Organism IDsRelated clustersLength
Role
P97500MYT1L_MOUSEMyelin transcription factor 1-like proteinMus musculus (Mouse)10090UniRef100_P97500
1,187Representative
F1M8L4F1M8L4_RATMyelin transcription factor 1-like proteinRattus norvegicus (Rat)10116UniRef100_F1M8L4
952
UPI0003D6EE84myelin transcription factor 1-like protein isoform 4Mus musculus (Mouse)10090UniRef100_UPI0003D6EE84
1,189Seed
UPI0011147749myelin transcription factor 1-like protein isoform X1Mus pahari (Gairdner's shrew-mouse) (Coelomys pahari)10093UniRef100_UPI0011147749
1,189
UPI0011147940myelin transcription factor 1-like protein isoform X9Mus pahari (Gairdner's shrew-mouse) (Coelomys pahari)10093UniRef100_UPI0011147749
1,014
UPI000A307B38myelin transcription factor 1-like protein isoform X2Mus pahari (Gairdner's shrew-mouse) (Coelomys pahari)10093UniRef100_UPI000A307B38
1,187
UPI000981D683myelin transcription factor 1-like protein isoform X2Castor canadensis (American beaver)51338UniRef100_UPI000981D683
1,186
UPI0011AEB375myelin transcription factor 1-like protein isoform X6Mus musculus (Mouse)10090UniRef100_UPI0011AEB375
1,166
UPI001114ACB3myelin transcription factor 1-like protein isoform X6Mus pahari (Gairdner's shrew-mouse) (Coelomys pahari)10093UniRef100_UPI001114ACB3
1,151
UPI0003D6E761myelin transcription factor 1-like protein isoform X9Mus musculus (Mouse)10090UniRef100_UPI0003D6E761
1,151
UPI0009809B9Fmyelin transcription factor 1-like protein isoform X3Castor canadensis (American beaver)51338UniRef100_UPI0009809B9F
1,150
UPI0003D75A4Fmyelin transcription factor 1-like protein isoform X10Mus musculus (Mouse)10090UniRef100_UPI0003D75A4F
1,149
UPI0009812E1Bmyelin transcription factor 1-like protein isoform X4Castor canadensis (American beaver)51338UniRef100_UPI0009812E1B
1,148
UPI001111749Cmyelin transcription factor 1-like protein isoform X5Mus caroli (Ryukyu mouse) (Ricefield mouse)10089UniRef100_UPI001111749C
1,128

Sequence

Representative sequenceiLengthMass (Da)Tools
P97500

Checksumi: 85A1B239FA198F2E

FASTA1,187132,945
        10         20         30         40         50
MDVDSEEKRH RTRSKGVRVP VEPAIQELFS CPTPGCDGSG HVSGKYARHR
60 70 80 90 100
SVYGCPLAKK RKTQDKQPQE PAPKRKPFAV KADSSSVDEC YESDGTEDMD
110 120 130 140 150
DKEEDDDEEF SEDNDEQGDD DDEDEVDRED EEEIEEEDDE EDDDDEDGDD
160 170 180 190 200
VEEEEEDDDE EEEEEEEEEE NEDHQMSCTR IMQDTDKDDN NNDEYDNYDE
210 220 230 240 250
LVAKSLLNLG KIAEDAAYRA RTESEMNSNT SNSLEDDSDK NENLGRKSEL
260 270 280 290 300
SLDLDSDVVR ETVDSLKLLA QGHGVVLSEN ISDRSYAEGM SQQDSRNMNY
310 320 330 340 350
VMLGKPMNNG LMEKMVEESD EEVCLSSLEC LRNQCFDLAR KLSETNPQDR
360 370 380 390 400
SQPPNMSVRQ HVRQEDDFPG RTPDRSYSDM MNLMRLEEQL SPRSRTFSSC
410 420 430 440 450
AKEDGCHERD DDTTSVNSDR SEEVFDMTKG NLTLLEKAIA LETERAKAMR
460 470 480 490 500
EKMAMDAGRR DNLRSYEDQS PRQLAGEDRK SKSSDSHVKK PYYGKDPSRT
510 520 530 540 550
EKRESKCPTP GCDGTGHVTG LYPHHRSLSG CPHKDRVPPE ILAMHENVLK
560 570 580 590 600
CPTPGCTGRG HVNSNRNSHR SLSGCPIAAA EKLAKAQEKH QSCDVSKSNQ
610 620 630 640 650
ASDRVLRPMC FVKQLEIPQY GYRNNVPTTT PRSNLAKELE KYSKTSFEYN
660 670 680 690 700
SYDNHTYGKR AIAPKVQTRD ISPKGYDDAK RYCKNASPSS STTSSYAPSS
710 720 730 740 750
SSNLSCGGGS SASSTCSKSS FDYTHDMEAA HMAATAILNL STRCREMPQN
760 770 780 790 800
LSTKPQDLCT ARNPDMEVDE NGTLDLSMNK QRPRDSCCPV LTPLEPMSPQ
810 820 830 840 850
QQAVMSSRCF QLSEGDCWDL PVDYTKMKPR RVDEDEPKEI TPEDLDPFQE
860 870 880 890 900
ALEERRYPGE VTIPSPKPKY PQCKESKKDL ITLSGCPLAD KSIRSMLATS
910 920 930 940 950
SQELKCPTPG CDGSGHITGN YASHRSLSGC PRAKKSGIRI AQSKEDKEDQ
960 970 980 990 1000
EPIRCPVPGC DGQGHITGKY ASHRSASGCP LAAKRQKDGY LNGSQFSWKS
1010 1020 1030 1040 1050
VKTEGMSCPT PGCDGSGHVS GSFLTHRSLS GCPRATSAMK KAKLSGEQML
1060 1070 1080 1090 1100
TIKQRASNGI ENDEEIKQLD EEIKELNESN SQMEADMIKL RTQITTMESN
1110 1120 1130 1140 1150
LKTIEEENKV IEQQNESLLH ELANLSQSLI HSLANIQLPH MDPINEQNFD
1160 1170 1180
AYVTTLTEMY TNQDRYQSPE NKALLENIKQ AVRGIQV
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again