Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
>UniRef90_P9WHD2 50S ribosomal protein L17 n=36 Tax=Mycobacterium tuberculosis complex TaxID=77643 RepID=RL17_MYCTO MPKPTKGPRLGGSSSHQKAILANLATSLFEHGRITTTEPKARALRPYAEKLITHAKKGAL HNRREVLKKLRDKDVVHTLFAEIGPFFADRDGGYTRIIKIEARKGDNAPMAVIELVREKT VTSEANRARRVAAAQAKAKKAAAMPTEESEAKPAEEGDVVGASEPDAKAPEEPPTEAPEN

Members

Expand cluster to 50% identity.
List component clusters with 100% identity.
1 to 25 of 36  Show
Cluster membersEntry nameProtein names
Organisms
Organism IDsRelated clustersLength
Role
P9WHD2RL17_MYCTO50S ribosomal protein L17Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)83331UniRef100_P9WHD2
180Representative
P0A5V5RL17_MYCBO50S ribosomal protein L17Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)233413UniRef100_P0A5V5
180
A1KPE2RL17_MYCBP50S ribosomal protein L17Mycobacterium bovis (strain BCG / Pasteur 1173P2)410289UniRef100_P0A5V5
180
C1AHR4RL17_MYCBT50S ribosomal protein L17Mycobacterium bovis (strain BCG / Tokyo 172 / ATCC 35737 / TMC 1019)561275UniRef100_P0A5V5
180
A5U8D2RL17_MYCTA50S ribosomal protein L17Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra)419947UniRef100_P0A5V5
180
P9WHD3RL17_MYCTU50S ribosomal protein L17Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)83332UniRef100_P0A5V5
180
A0A0T9D567A0A0T9D567_MYCTX50S ribosomal protein L17Mycobacterium tuberculosis1773UniRef100_P9WHD2
180
A0A120IQE2A0A120IQE2_MYCBI50S ribosomal protein L17Mycobacterium tuberculosis variant bovis BCG33892UniRef100_A0A120IQE2
216Seed
R4MN81R4MN81_MYCTX50S ribosomal protein L17Mycobacterium tuberculosis CAS/NITR2041310114UniRef100_P0A5V5
180
A0A4U7MIL4A0A4U7MIL4_MYCBI50S ribosomal protein L17Mycobacterium bovis1765UniRef100_P0A5V5
180
A0A045IVA2A0A045IVA2_MYCTX50S ribosomal protein L17Mycobacterium tuberculosis1773UniRef100_P0A5V5
180
A0A328G9P4A0A328G9P4_MYCTX50S ribosomal protein L17Mycobacterium tuberculosis variant pinnipedii194542UniRef100_P0A5V5
180
A0A501NX99A0A501NX99_9MYCO50S ribosomal protein L17Mycobacterium orygis1305738UniRef100_P0A5V5
180
G0TIW0G0TIW0_MYCCP50S ribosomal protein L17Mycobacterium canettii (strain CIPT 140010059)1048245UniRef100_P0A5V5
180
UPI0005E6CC5350S ribosomal protein L17Mycobacterium tuberculosis1773UniRef100_UPI0005E6CC53
180
UPI0002A5916C50S ribosomal protein L17Mycobacterium canettii78331UniRef100_UPI0002A5916C
180
UPI0002A5968750S ribosomal protein L17Mycobacterium canettii78331UniRef100_UPI0002A59687
180
UPI0005DFDABE50S ribosomal protein L17Mycobacterium tuberculosis1773UniRef100_UPI0005DFDABE
180
UPI0001BC910650S ribosomal protein L17Mycobacterium tuberculosis1773UniRef100_UPI0001BC9106
180
UPI000459E1DC50S ribosomal protein L17Mycobacterium tuberculosis1773UniRef100_UPI000459E1DC
180
UPI00045A434950S ribosomal protein L17Mycobacterium tuberculosis1773UniRef100_UPI00045A4349
180
UPI0008A9E70D50S ribosomal protein L17Mycobacterium tuberculosis1773UniRef100_UPI0008A9E70D
180
UPI00097AC00350S ribosomal protein L17Mycobacterium tuberculosis1773UniRef100_UPI00097AC003
180
UPI0004599BB650S ribosomal protein L17Mycobacterium tuberculosis1773UniRef100_UPI0004599BB6
180
UPI000CEDCE4750S ribosomal protein L17Mycobacterium tuberculosis1773UniRef100_UPI000CEDCE47
180

Sequence

Representative sequenceiLengthMass (Da)Tools
P9WHD2

Checksumi: BCA33FB5ED71999F

FASTA18019,505
        10         20         30         40         50
MPKPTKGPRL GGSSSHQKAI LANLATSLFE HGRITTTEPK ARALRPYAEK
60 70 80 90 100
LITHAKKGAL HNRREVLKKL RDKDVVHTLF AEIGPFFADR DGGYTRIIKI
110 120 130 140 150
EARKGDNAPM AVIELVREKT VTSEANRARR VAAAQAKAKK AAAMPTEESE
160 170 180
AKPAEEGDVV GASEPDAKAP EEPPTEAPEN
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again