Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
>UniRef90_Q01094 Transcription factor E2F1 n=24 Tax=Boreoeutheria TaxID=1437010 RepID=E2F1_HUMAN MALAGAPAGGPCAPALEALLGAGALRLLDSSQIVIISAAQDASAPPAPTGPAAPAAGPCD PDLLLFATPQAPRPTPSAPRPALGRPPVKRRLDLETDHQYLAESSGPARGRGRHPGKGVK SPGEKSRYETSLNLTTKRFLELLSHSADGVVDLNWAAEVLKVQKRRIYDITNVLEGIQLI AKKSKNHIQWLGSHTTVGVGGRLEGLTQDLRQLQESEQQLDHLMNICTTQLRLLSEDTDS QRLAYVTCQDLRSIADPAEQMVMVIKAPPETQLQAVDSSENFQISLKSKQGPIDVFLCPE ETVGGISPGKTPSQEVTSEEENRATDSATIVSPPPSSPPSSLTTDPSQSLLSLEQEPLLS RMGSLRAPVDEDRLSPLVAADSLLEHVREDFSGLLPEEFISLSPPHEALDYHFGLEEGEG IRDLFDCDFGDLTPLDF

Members

Expand cluster to 50% identity.
List component clusters with 100% identity.
1 to 24 of 24  Show
Cluster membersEntry nameProtein names
Organisms
Organism IDsRelated clustersLength
Role
Q01094E2F1_HUMANTranscription factor E2F1Homo sapiens (Human)9606UniRef100_Q01094
437Representative
A0A2K6QR90A0A2K6QR90_RHIROE2F_TDP domain-containing proteinRhinopithecus roxellana (Golden snub-nosed monkey) (Pygathrix roxellana)61622UniRef100_A0A2K6QR90
485
F6VUA0F6VUA0_CALJAE2F transcription factor 1Callithrix jacchus (White-tufted-ear marmoset)9483UniRef100_F6VUA0
439
A0A2K5W061A0A2K5W061_MACFAE2F_TDP domain-containing proteinMacaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)9541UniRef100_A0A2K5W061
437
A0A2J8VIY3A0A2J8VIY3_PONABE2F1 isoform 1Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii)9601UniRef100_A0A2J8VIY3
437
F7DEJ9F7DEJ9_MACMUE2F_TDP domain-containing proteinMacaca mulatta (Rhesus macaque)9544UniRef100_F7DEJ9
437
A0A2K5N5J8A0A2K5N5J8_CERATE2F_TDP domain-containing proteinCercocebus atys (Sooty mangabey) (Cercocebus torquatus atys)9531UniRef100_F7DEJ9
437
K7CCS1K7CCS1_PANTRE2F transcription factor 1Pan troglodytes (Chimpanzee)9598UniRef100_K7CCS1
437
A0A0D9RIK1A0A0D9RIK1_CHLSBE2F_TDP domain-containing proteinChlorocebus sabaeus (Green monkey) (Cercopithecus sabaeus)60711UniRef100_A0A0D9RIK1
437
H2QK72H2QK72_PANTRE2F transcription factor 1Pan troglodytes (Chimpanzee)9598UniRef100_H2QK72
437
A0A2K6B440A0A2K6B440_MACNEE2F_TDP domain-containing proteinMacaca nemestrina (Pig-tailed macaque)9545UniRef100_A0A2K6B440
437
G3QM04G3QM04_GORGOE2F transcription factor 1Gorilla gorilla gorilla (Western lowland gorilla)9595UniRef100_G3QM04
437
A0A2K6FW27A0A2K6FW27_PROCOE2F_TDP domain-containing proteinPropithecus coquereli (Coquerel's sifaka) (Propithecus verreauxi coquereli)379532UniRef100_A0A2K6FW27
436
A0A1S3EPF2A0A1S3EPF2_DIPORtranscription factor E2F1Dipodomys ordii (Ord's kangaroo rat)10020UniRef100_A0A1S3EPF2
436
A0A4X1T1E0A0A4X1T1E0_PIGE2F transcription factor 1Sus scrofa (Pig)9823UniRef100_A0A4X1T1E0
434
UPI0005331B7Ctranscription factor E2F1Rhinopithecus roxellana (Golden snub-nosed monkey) (Pygathrix roxellana)61622UniRef100_A0A2K6QR90
529Seed
UPI0008408922LOW QUALITY PROTEIN: transcription factor E2F1Callithrix jacchus (White-tufted-ear marmoset)9483UniRef100_UPI0008408922
439
UPI000C2B1200transcription factor E2F1Piliocolobus tephrosceles (Ugandan red Colobus)591936UniRef100_UPI000C2B1200
437
UPI00045E44D8transcription factor E2F1Chlorocebus sabaeus (Green monkey) (Cercopithecus sabaeus)60711UniRef100_UPI00045E44D8
436
UPI000939E0A4transcription factor E2F1Hipposideros armiger (great roundleaf bat)186990UniRef100_UPI000939E0A4
436
UPI000FFF75C0transcription factor E2F1Marmota flaviventris (Yellow-bellied marmot)93162UniRef100_UPI000FFF75C0
436
UPI00018B3FE7transcription factor E2F1Pteropus vampyrus (Large flying fox)132908UniRef100_UPI00018B3FE7
436
UPI0003502CE8transcription factor E2F1Heterocephalus glaber (Naked mole rat)10181UniRef100_UPI0003502CE8
431
UPI0009826205LOW QUALITY PROTEIN: transcription factor E2F1Castor canadensis (American beaver)51338UniRef100_UPI0009826205
430

Sequence

Representative sequenceiLengthMass (Da)Tools
Q01094

Checksumi: 003B3F654F0C60DF

FASTA43746,920
        10         20         30         40         50
MALAGAPAGG PCAPALEALL GAGALRLLDS SQIVIISAAQ DASAPPAPTG
60 70 80 90 100
PAAPAAGPCD PDLLLFATPQ APRPTPSAPR PALGRPPVKR RLDLETDHQY
110 120 130 140 150
LAESSGPARG RGRHPGKGVK SPGEKSRYET SLNLTTKRFL ELLSHSADGV
160 170 180 190 200
VDLNWAAEVL KVQKRRIYDI TNVLEGIQLI AKKSKNHIQW LGSHTTVGVG
210 220 230 240 250
GRLEGLTQDL RQLQESEQQL DHLMNICTTQ LRLLSEDTDS QRLAYVTCQD
260 270 280 290 300
LRSIADPAEQ MVMVIKAPPE TQLQAVDSSE NFQISLKSKQ GPIDVFLCPE
310 320 330 340 350
ETVGGISPGK TPSQEVTSEE ENRATDSATI VSPPPSSPPS SLTTDPSQSL
360 370 380 390 400
LSLEQEPLLS RMGSLRAPVD EDRLSPLVAA DSLLEHVRED FSGLLPEEFI
410 420 430
SLSPPHEALD YHFGLEEGEG IRDLFDCDFG DLTPLDF
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again