Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
>UniRef90_Q13887 Krueppel-like factor 5 n=78 Tax=Theria TaxID=32525 RepID=KLF5_HUMAN MATRVLSMSARLGPVPQPPAPQDEPVFAQLKPVLGAANPARDAALFPGEELKHAHHRPQA QPAPAQAPQPAQPPATGPRLPPEDLVQTRCEMEKYLTPQLPPVPIIPEHKKYRRDSASVV DQFFTDTEGLPYSINMNVFLPDITHLRTGLYKSQRPCVTHIKTEPVAIFSHQSETTAPPP APTQALPEFTSIFSSHQTAAPEVNNIFIKQELPTPDLHLSVPTQQGHLYQLLNTPDLDMP SSTNQTAAMDTLNVSMSAAMAGLNTHTSAVPQTAVKQFQGMPPCTYTMPSQFLPQQATYF PPSPPSSEPGSPDRQAEMLQNLTPPPSYAATIASKLAIHNPNLPTTLPVNSQNIQPVRYN RRSNPDLEKRRIHYCDYPGCTKVYTKSSHLKAHLRTHTGEKPYKCTWEGCDWRFARSDEL TRHYRKHTGAKPFQCGVCNRSFSRSDHLALHMKRHQN

Members

Expand cluster to 50% identity.
List component clusters with 100% identity.
1 to 25 of 78  Show
Cluster membersEntry nameProtein names
Organisms
Organism IDsRelated clustersLength
Role
Q13887KLF5_HUMANKrueppel-like factor 5Homo sapiens (Human)9606UniRef100_Q13887
457Representative
Q5T6X2Q5T6X2_HUMANEpididymis secretory sperm binding proteinHomo sapiens (Human)9606UniRef100_Q13887
457
Q13887-4Isoform 4 of KLF5_HUMAN4Homo sapiens (Human)9606UniRef100_Q13887
366
A0A3Q7WFR5A0A3Q7WFR5_URSARKrueppel-like factor 5Ursus arctos horribilis116960UniRef100_A0A3Q7WFR5
458
A0A384BQK2A0A384BQK2_URSMAKrueppel-like factor 5Ursus maritimus (Polar bear) (Thalarctos maritimus)29073UniRef100_A0A3Q7WFR5
367
D2GZ24D2GZ24_AILMEKruppel like factor 5 (Fragment)Ailuropoda melanoleuca (Giant panda)9646UniRef100_A0A3Q7WFR5
371
A0A2K6F721A0A2K6F721_PROCOUncharacterized proteinPropithecus coquereli (Coquerel's sifaka) (Propithecus verreauxi coquereli)379532UniRef100_A0A2K6F721
457
G3RWJ2G3RWJ2_GORGOKruppel like factor 5Gorilla gorilla gorilla (Western lowland gorilla)9595UniRef100_G3RWJ2
457
F6U556F6U556_CALJAKrueppel-like factor 5Callithrix jacchus (White-tufted-ear marmoset)9483UniRef100_F6U556
457
H2NK19H2NK19_PONABKLF5 isoform 3Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii)9601UniRef100_H2NK19
457
F7GX31F7GX31_MACMUUncharacterized proteinMacaca mulatta (Rhesus macaque)9544UniRef100_F7GX31
457
A0A096N7X3A0A096N7X3_PAPANUncharacterized proteinPapio anubis (Olive baboon)9555UniRef100_F7GX31
457
A0A2K5TVB5A0A2K5TVB5_MACFAUncharacterized proteinMacaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)9541UniRef100_F7GX31
457
A0A2K6BC77A0A2K6BC77_MACNEUncharacterized proteinMacaca nemestrina (Pig-tailed macaque)9545UniRef100_F7GX31
457
A0A2K5JSV8A0A2K5JSV8_COLAPUncharacterized proteinColobus angolensis palliatus (Peters' Angolan colobus)336983UniRef100_A0A2K5JSV8
457
M3YFP7M3YFP7_MUSPFUncharacterized proteinMustela putorius furo (European domestic ferret) (Mustela furo)9669UniRef100_M3YFP7
457
A0A2K6R4W8A0A2K6R4W8_RHIROUncharacterized proteinRhinopithecus roxellana (Golden snub-nosed monkey) (Pygathrix roxellana)61622UniRef100_A0A2K6R4W8
457
A0A2Y9JDK4A0A2Y9JDK4_ENHLUKrueppel-like factor 5Enhydra lutris kenyoni391180UniRef100_A0A2Y9JDK4
457
A0A2K5RZ83A0A2K5RZ83_CEBCAUncharacterized proteinCebus capucinus imitator1737458UniRef100_A0A2K5RZ83
457
A0A2K5LLH2A0A2K5LLH2_CERATUncharacterized proteinCercocebus atys (Sooty mangabey) (Cercocebus torquatus atys)9531UniRef100_A0A2K5LLH2
457
A1XWJ7A1XWJ7_PIGKruppel-like factor 5Sus scrofa (Pig)9823UniRef100_A1XWJ7
457
A0A2K5DWG9A0A2K5DWG9_AOTNAUncharacterized proteinAotus nancymaae (Ma's night monkey)37293UniRef100_A0A2K5DWG9
457
H0WLD3H0WLD3_OTOGAUncharacterized proteinOtolemur garnettii (Small-eared galago) (Garnett's greater bushbaby)30611UniRef100_H0WLD3
457
A0A3Q7PAG8A0A3Q7PAG8_CALURKrueppel-like factor 5 isoform X1Callorhinus ursinus (Northern fur seal)34884UniRef100_A0A3Q7PAG8
457
A0A3Q7P9P0A0A3Q7P9P0_CALURKrueppel-like factor 5 isoform X2Callorhinus ursinus (Northern fur seal)34884UniRef100_A0A3Q7PAG8
366

Sequence

Representative sequenceiLengthMass (Da)Tools
Q13887

Checksumi: 3BF12BE272716E57

FASTA45750,792
        10         20         30         40         50
MATRVLSMSA RLGPVPQPPA PQDEPVFAQL KPVLGAANPA RDAALFPGEE
60 70 80 90 100
LKHAHHRPQA QPAPAQAPQP AQPPATGPRL PPEDLVQTRC EMEKYLTPQL
110 120 130 140 150
PPVPIIPEHK KYRRDSASVV DQFFTDTEGL PYSINMNVFL PDITHLRTGL
160 170 180 190 200
YKSQRPCVTH IKTEPVAIFS HQSETTAPPP APTQALPEFT SIFSSHQTAA
210 220 230 240 250
PEVNNIFIKQ ELPTPDLHLS VPTQQGHLYQ LLNTPDLDMP SSTNQTAAMD
260 270 280 290 300
TLNVSMSAAM AGLNTHTSAV PQTAVKQFQG MPPCTYTMPS QFLPQQATYF
310 320 330 340 350
PPSPPSSEPG SPDRQAEMLQ NLTPPPSYAA TIASKLAIHN PNLPTTLPVN
360 370 380 390 400
SQNIQPVRYN RRSNPDLEKR RIHYCDYPGC TKVYTKSSHL KAHLRTHTGE
410 420 430 440 450
KPYKCTWEGC DWRFARSDEL TRHYRKHTGA KPFQCGVCNR SFSRSDHLAL

HMKRHQN
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again