Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
>UniRef90_Q16134-3 Isoform 2 of Electron transfer flavoprotein-ubiquinone oxidoreductase, mitochondrial n=25 Tax=Eutheria TaxID=9347 RepID=Isoform 3 of ETFD_HUMAN MLVPLAKLSCLGVNMERFAEEADVVIVGAGPAGLSAAVRLKQLAVAHEKDIRVCLVEKAA QIGAHTLSGACLDPGAFKELFPDWKEKGAPLNTPVTEDRFGILTEKYRIPVPILPGLPMN NHGNYIVRLGHLVSWMGEQAEALGVEVYPGYAAAEVLFHDDGSVKGIATNDVGIQKDGAP KATFERGLELHAKVTIFAEGCHGHLAKQLYKKFDLRANCEPQTYGIGLKELWVIDEKNWK PGRVDHTVGWPLDRHTYGGSFLYHLNEGEPLVALGLVVGLDYQNPYLSPFREFQRWKHHP SIRPTLEGGKRIAYGARALNEGGFQSIPKLTFPGGLLIGCSPGFMNVPKIKGTHTAMKSG ILAAESIFNQLTSENLQSKTIGLHVTEYEDNLKNSWVWKELYSVRNIRPSCHGVLGVYGG MIYTGIFYWILRGMEPWTLKHKGSDFERLKPAKDCTPIEYPKPDGQISFDLLSSVALSGT NHEHDQPAHLTLRDDSIPVNRNLSIYDGPEQRFCPAGVYEFVPVEQGDGFRLQINAQNCV HCKTCDIKDPSQNINWVVPEGGGGPAYNGM

Members

Expand cluster to 50% identity.
List component clusters with 100% identity.
1 to 25 of 25  Show
Cluster membersEntry nameProtein names
Organisms
Organism IDsRelated clustersLength
Role
Q16134-3Isoform 3 of ETFD_HUMAN2Homo sapiens (Human)9606UniRef100_Q16134-3
570Representative
A0A2R9B074A0A2R9B074_PANPA4Fe-4S ferredoxin-type domain-containing proteinPan paniscus (Pygmy chimpanzee) (Bonobo)9597UniRef100_A0A2R9B074
619
A0A2K5KDV5A0A2K5KDV5_COLAP4Fe-4S ferredoxin-type domain-containing proteinColobus angolensis palliatus (Peters' Angolan colobus)336983UniRef100_A0A2K5KDV5
619
G3S6S0G3S6S0_GORGOElectron transfer flavoprotein dehydrogenaseGorilla gorilla gorilla (Western lowland gorilla)9595UniRef100_G3S6S0
619
A0A2I3HI67A0A2I3HI67_NOMLE4Fe-4S ferredoxin-type domain-containing proteinNomascus leucogenys (Northern white-cheeked gibbon) (Hylobates leucogenys)61853UniRef100_A0A2I3HI67
619
A0A096NDL8A0A096NDL8_PAPAN4Fe-4S ferredoxin-type domain-containing proteinPapio anubis (Olive baboon)9555UniRef100_A0A096NDL8
619
A0A1U7QWG6A0A1U7QWG6_MESAUelectron transfer flavoprotein-ubiquinone oxidoreductase, mitochondrial isoform X1Mesocricetus auratus (Golden hamster)10036UniRef100_A0A1U7QWG6
617
A0A3Q0CVC9A0A3Q0CVC9_MESAUelectron transfer flavoprotein-ubiquinone oxidoreductase, mitochondrial isoform X2Mesocricetus auratus (Golden hamster)10036UniRef100_A0A1U7QWG6
556
A0A2R9AWB4A0A2R9AWB4_PANPA4Fe-4S ferredoxin-type domain-containing proteinPan paniscus (Pygmy chimpanzee) (Bonobo)9597UniRef100_A0A2R9AWB4
570
A0A2J8W097A0A2J8W097_PONABETFDH isoform 2Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii)9601UniRef100_A0A2J8W097
570
A0A2Y9RD89A0A2Y9RD89_TRIMAelectron transfer flavoprotein-ubiquinone oxidoreductase, mitochondrial isoform X2Trichechus manatus latirostris (Florida manatee)127582UniRef100_A0A2Y9RD89
570
G5AXY1G5AXY1_HETGAElectron transfer flavoprotein-ubiquinone oxidoreductase, mitochondrialHeterocephalus glaber (Naked mole rat)10181UniRef100_G5AXY1
570
A0A2J8MV26A0A2J8MV26_PANTRETFDH isoform 6Pan troglodytes (Chimpanzee)9598UniRef100_A0A2J8MV26
570
A0A2I2ZYR4A0A2I2ZYR4_GORGOElectron transfer flavoprotein dehydrogenaseGorilla gorilla gorilla (Western lowland gorilla)9595UniRef100_A0A2J8MV26
570
A0A2I3LIC0A0A2I3LIC0_PAPAN4Fe-4S ferredoxin-type domain-containing proteinPapio anubis (Olive baboon)9555UniRef100_A0A2I3LIC0
570
A0A2I3HFJ2A0A2I3HFJ2_NOMLE4Fe-4S ferredoxin-type domain-containing proteinNomascus leucogenys (Northern white-cheeked gibbon) (Hylobates leucogenys)61853UniRef100_A0A2I3HFJ2
570
UPI000695EEA4electron transfer flavoprotein-ubiquinone oxidoreductase, mitochondrialChinchilla lanigera (Long-tailed chinchilla) (Chinchilla villidera)34839UniRef100_UPI000695EEA4
685Seed
UPI00046BBC76electron transfer flavoprotein-ubiquinone oxidoreductase, mitochondrial isoform X1Eptesicus fuscus (Big brown bat) (Vespertilio fuscus)29078UniRef100_UPI00046BBC76
621
UPI0004F0870Delectron transfer flavoprotein-ubiquinone oxidoreductase, mitochondrial isoform X2Pan paniscus (Pygmy chimpanzee) (Bonobo)9597UniRef100_A0A2R9B074
556
UPI0000E2062Aelectron transfer flavoprotein-ubiquinone oxidoreductase, mitochondrial isoform X2Pan troglodytes (Chimpanzee)9598UniRef100_G3S6S0
556
UPI000B7B399Eelectron transfer flavoprotein-ubiquinone oxidoreductase, mitochondrial isoform X2Papio anubis (Olive baboon)9555UniRef100_A0A096NDL8
556
UPI000DC16F90electron transfer flavoprotein-ubiquinone oxidoreductase, mitochondrial isoform X1Theropithecus gelada (Gelada baboon)9565UniRef100_UPI000DC16F90
617
UPI000A314A67electron transfer flavoprotein-ubiquinone oxidoreductase, mitochondrialMus caroli (Ryukyu mouse) (Ricefield mouse)10089UniRef100_UPI000A314A67
616
UPI00100E9226electron transfer flavoprotein-ubiquinone oxidoreductase, mitochondrial isoform X2Ovis aries (Sheep)9940UniRef100_UPI00100E9226
607
UPI000DC18E21electron transfer flavoprotein-ubiquinone oxidoreductase, mitochondrial isoform X2Theropithecus gelada (Gelada baboon)9565UniRef100_UPI000DC18E21
570

Sequence

Representative sequenceiLengthMass (Da)Tools
Q16134-3

Checksumi: 9F62F0271FA24BB0

FASTA57062,825
        10         20         30         40         50
MLVPLAKLSC LGVNMERFAE EADVVIVGAG PAGLSAAVRL KQLAVAHEKD
60 70 80 90 100
IRVCLVEKAA QIGAHTLSGA CLDPGAFKEL FPDWKEKGAP LNTPVTEDRF
110 120 130 140 150
GILTEKYRIP VPILPGLPMN NHGNYIVRLG HLVSWMGEQA EALGVEVYPG
160 170 180 190 200
YAAAEVLFHD DGSVKGIATN DVGIQKDGAP KATFERGLEL HAKVTIFAEG
210 220 230 240 250
CHGHLAKQLY KKFDLRANCE PQTYGIGLKE LWVIDEKNWK PGRVDHTVGW
260 270 280 290 300
PLDRHTYGGS FLYHLNEGEP LVALGLVVGL DYQNPYLSPF REFQRWKHHP
310 320 330 340 350
SIRPTLEGGK RIAYGARALN EGGFQSIPKL TFPGGLLIGC SPGFMNVPKI
360 370 380 390 400
KGTHTAMKSG ILAAESIFNQ LTSENLQSKT IGLHVTEYED NLKNSWVWKE
410 420 430 440 450
LYSVRNIRPS CHGVLGVYGG MIYTGIFYWI LRGMEPWTLK HKGSDFERLK
460 470 480 490 500
PAKDCTPIEY PKPDGQISFD LLSSVALSGT NHEHDQPAHL TLRDDSIPVN
510 520 530 540 550
RNLSIYDGPE QRFCPAGVYE FVPVEQGDGF RLQINAQNCV HCKTCDIKDP
560 570
SQNINWVVPE GGGGPAYNGM
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again