Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
>UniRef90_Q16643-3 Isoform 3 of Drebrin n=42 Tax=Simiiformes TaxID=314293 RepID=Isoform 3 of DREB_HUMAN MAGVSFSGHRLELLAAYEEVIREESAADWALYTYEDGSDDLKLAASGEGGLQELSGHFEN QKVMYGFCSVKDSQAALPKYVLINWVGEDVPDARKCACASHVAKVAEFFQGVDVIVNASS VEDIDAGAIGQRLSNGLARLSSPVLHRLRLREDENAEPVGTTYQKTDAAVEMKRINREQF WEQAKKEEELRKEEERKKALDERLRFEQERMEQERQEQEERERRYREREQQIEEHRRKQQ TLEAEEAKRRLKEQSIFGDHRDEEEETHMKKSESEVEEAAAIIAQRPDNPREFFKQQERV ASASAGSCDVPSPFNHRPGRPYCPFIKASDSGPSSSSSSSSSPPRTPFPYITCHRTPNLS SSLPCSHLDSHRRMAPTPIPTRSPSDSSTASTPVAEQIERALDEVTSSQPPPLPPPPPPA QETQEPSPILDSEETRAAAPQAWAGPMEEPPQAQAPPRGPGSPAEDLMFMESAEQAVLAA PVEPATADATEIHDAADTIETDTATADTTVANNVPPAATSLIDLWPGNGEGASTLQGEPR APTPPSGTEVTLAEVPLLDEVAPEPLLPAGEGCATLLNFDELPEPPATFCDPEEVEGESL AAPQTPTLPSALEELEQEQEPEPHLLTNGETTQKEGTQASEGYFSQSQEEEFAQSEELCA KAPPPVFYNKPPEIDITCWDADPVPEEEEGFEGGD

Members

Expand cluster to 50% identity.
List component clusters with 100% identity.
1 to 25 of 42  Show
Cluster membersEntry nameProtein names
Organisms
Organism IDsRelated clustersLength
Role
Q16643-3Isoform 3 of DREB_HUMAN3, Drebrin AHomo sapiens (Human)9606UniRef100_Q16643-3
695Representative
A0A2K5P8D4A0A2K5P8D4_CERATADF-H domain-containing proteinCercocebus atys (Sooty mangabey) (Cercocebus torquatus atys)9531UniRef100_A0A2K5P8D4
696
A0A2J8RDT3A0A2J8RDT3_PONABDBN1 isoform 4Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii)9601UniRef100_A0A2J8RDT3
695
H2PHI6H2PHI6_PONABDrebrin 1Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii)9601UniRef100_A0A2J8RDT3
632
A0A2K5P8D3A0A2K5P8D3_CERATADF-H domain-containing proteinCercocebus atys (Sooty mangabey) (Cercocebus torquatus atys)9531UniRef100_A0A2K5P8D3
695
F6WFH5F6WFH5_MACMUADF-H domain-containing proteinMacaca mulatta (Rhesus macaque)9544UniRef100_F6WFH5
695
A0A2K5W3X4A0A2K5W3X4_MACFAADF-H domain-containing proteinMacaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)9541UniRef100_F6WFH5
695
A0A0D9R8U2A0A0D9R8U2_CHLSBADF-H domain-containing proteinChlorocebus sabaeus (Green monkey) (Cercopithecus sabaeus)60711UniRef100_A0A0D9R8U2
695
Q4R565Q4R565_MACFABrain cDNA, clone: QccE-17231, similar to human drebrin 1 (DBN1), transcript variant 2Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)9541UniRef100_Q4R565
695
A0A2K6BIT5A0A2K6BIT5_MACNEADF-H domain-containing proteinMacaca nemestrina (Pig-tailed macaque)9545UniRef100_A0A2K6BIT5
695
A0A2Z6ATB6A0A2Z6ATB6_HUMANDrebrin AHomo sapiens (Human)9606UniRef100_A0A2Z6ATB6
695
A0A2J8J5K0A0A2J8J5K0_PANTRDBN1 isoform 1Pan troglodytes (Chimpanzee)9598UniRef100_A0A2J8J5K0
695
A0A096N9V5A0A096N9V5_PAPANADF-H domain-containing proteinPapio anubis (Olive baboon)9555UniRef100_A0A096N9V5
695
A0A2K5IYC7A0A2K5IYC7_COLAPADF-H domain-containing proteinColobus angolensis palliatus (Peters' Angolan colobus)336983UniRef100_A0A2K5IYC7
688
A0A2K6PP30A0A2K6PP30_RHIROADF-H domain-containing proteinRhinopithecus roxellana (Golden snub-nosed monkey) (Pygathrix roxellana)61622UniRef100_A0A2K6PP30
688
A0A2K6JTT2A0A2K6JTT2_RHIBEADF-H domain-containing proteinRhinopithecus bieti (Black snub-nosed monkey) (Pygathrix bieti)61621UniRef100_A0A2K6JTT2
688
A0A2K5YHW5A0A2K5YHW5_MANLEADF-H domain-containing proteinMandrillus leucophaeus (Drill) (Papio leucophaeus)9568UniRef100_A0A2K5YHW5
688
A0A2R9BMB3A0A2R9BMB3_PANPAADF-H domain-containing proteinPan paniscus (Pygmy chimpanzee) (Bonobo)9597UniRef100_A0A2R9BMB3
677
A0A2K6S3Q9A0A2K6S3Q9_SAIBBDrebrin 1Saimiri boliviensis boliviensis (Bolivian squirrel monkey)39432UniRef100_A0A2K6S3Q9
668
D6R9W4D6R9W4_HUMANDrebrin (Fragment)Homo sapiens (Human)9606UniRef100_D6R9W4
317
A0A2J8RDS6A0A2J8RDS6_PONABDBN1 isoform 7 (Fragment)Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii)9601UniRef100_D6R9W4
317
A0A2J8J5K2A0A2J8J5K2_PANTRDBN1 isoform 6 (Fragment)Pan troglodytes (Chimpanzee)9598UniRef100_D6R9W4
317
UPI00062A8F75LOW QUALITY PROTEIN: drebrinNomascus leucogenys (Northern white-cheeked gibbon) (Hylobates leucogenys)61853UniRef100_UPI00062A8F75
821Seed
UPI0005D005BEdrebrin isoform X1Homo sapiens (Human)9606UniRef100_UPI0005D005BE
697
UPI0003EAF952drebrin isoform X5Homo sapiens (Human)9606UniRef100_UPI0005D005BE
632

Sequence

Representative sequenceiLengthMass (Da)Tools
Q16643-3

Checksumi: C4E1FEC8D932603C

FASTA69576,300
        10         20         30         40         50
MAGVSFSGHR LELLAAYEEV IREESAADWA LYTYEDGSDD LKLAASGEGG
60 70 80 90 100
LQELSGHFEN QKVMYGFCSV KDSQAALPKY VLINWVGEDV PDARKCACAS
110 120 130 140 150
HVAKVAEFFQ GVDVIVNASS VEDIDAGAIG QRLSNGLARL SSPVLHRLRL
160 170 180 190 200
REDENAEPVG TTYQKTDAAV EMKRINREQF WEQAKKEEEL RKEEERKKAL
210 220 230 240 250
DERLRFEQER MEQERQEQEE RERRYREREQ QIEEHRRKQQ TLEAEEAKRR
260 270 280 290 300
LKEQSIFGDH RDEEEETHMK KSESEVEEAA AIIAQRPDNP REFFKQQERV
310 320 330 340 350
ASASAGSCDV PSPFNHRPGR PYCPFIKASD SGPSSSSSSS SSPPRTPFPY
360 370 380 390 400
ITCHRTPNLS SSLPCSHLDS HRRMAPTPIP TRSPSDSSTA STPVAEQIER
410 420 430 440 450
ALDEVTSSQP PPLPPPPPPA QETQEPSPIL DSEETRAAAP QAWAGPMEEP
460 470 480 490 500
PQAQAPPRGP GSPAEDLMFM ESAEQAVLAA PVEPATADAT EIHDAADTIE
510 520 530 540 550
TDTATADTTV ANNVPPAATS LIDLWPGNGE GASTLQGEPR APTPPSGTEV
560 570 580 590 600
TLAEVPLLDE VAPEPLLPAG EGCATLLNFD ELPEPPATFC DPEEVEGESL
610 620 630 640 650
AAPQTPTLPS ALEELEQEQE PEPHLLTNGE TTQKEGTQAS EGYFSQSQEE
660 670 680 690
EFAQSEELCA KAPPPVFYNK PPEIDITCWD ADPVPEEEEG FEGGD
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again