Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
>UniRef90_Q30KP9 Beta-defensin 135 n=3 Tax=Homininae TaxID=207598 RepID=DB135_HUMAN MATRSVLLALVVLNLLFYVPPGRSGPNVYIQKIFASCWRLQGTCRPKCLKNEQYRILCDT IHLCCVNPKYLPILTGK

Members

Expand cluster to 50% identity.
List component clusters with 100% identity.
1 to 3 of 3  Show
Cluster membersEntry nameProtein names
Organisms
Organism IDsRelated clustersLength
Role
Q30KP9DB135_HUMANBeta-defensin 135Homo sapiens (Human)9606UniRef100_Q30KP9
77Representative & Seed
G3QZ08G3QZ08_GORGOBeta-defensinGorilla gorilla gorilla (Western lowland gorilla)9595UniRef100_G3QZ08
77
H2R9W3H2R9W3_PANTRBeta-defensinPan troglodytes (Chimpanzee)9598UniRef100_H2R9W3
77

Sequence

Representative sequenceiLengthMass (Da)Tools
Q30KP9

Checksumi: 010E3EF6D54984F2

FASTA778,754
        10         20         30         40         50
MATRSVLLAL VVLNLLFYVP PGRSGPNVYI QKIFASCWRL QGTCRPKCLK
60 70
NEQYRILCDT IHLCCVNPKY LPILTGK
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again