Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
>UniRef90_Q32FD6 Tyrosine--tRNA ligase n=1641 RepID=SYY_SHIDS MASSNLIKQLQERGLVAQVTDEEALAERLAQGPIALYCGFDPTADSLHLGHLVPLLCLKR FQQAGHKPVALVGGATGLIGDPSFKAAERKLNTEETVQEWVDKIRKQVAPFLDFDCGENS AIAANNYDWFGNMNVLTFLRDIGKHFSVNQMINKEAVKQRLNREDQGISFIEFSYNLLQG YDFACLNKQYGVVLQIGGSDQWGNITSGIDLTRRLHQNQVFGLTVPLITKADGTKFGKTE GGAVWLDPKKTSPYKFYQFWINTADADVYRFLKFFTFMSIEEINALEEEDKNSGKAPRAQ YVLAEQVTRLVHGEEGLQAAKRITECLFSGSLSALSEADFEQLAQDGVPMVEMEKGADLM QALVDSELQPSRGQARKTIASNAITINGEKQSDPEYFFKEEDRLFGRFTLLRRGKKNYCL ICWK

Members

Expand cluster to 50% identity.
List component clusters with 100% identity.
1 to 25 of 1,641  Show
Cluster membersEntry nameProtein names
Organisms
Organism IDsRelated clustersLength
Role
Q32FD6SYY_SHIDSTyrosine--tRNA ligaseShigella dysenteriae serotype 1 (strain Sd197)300267UniRef100_Q32FD6
424Representative
C0Q5T3SYY_SALPCTyrosine--tRNA ligaseSalmonella paratyphi C (strain RKS4594)476213UniRef100_C0Q5T3
428
B5F6J8SYY_SALA4Tyrosine--tRNA ligaseSalmonella agona (strain SL483)454166UniRef100_C0Q5T3
424
Q57PI8SYY_SALCHTyrosine--tRNA ligaseSalmonella choleraesuis (strain SC-B67)321314UniRef100_C0Q5T3
424
B5FIF4SYY_SALDCTyrosine--tRNA ligaseSalmonella dublin (strain CT_02021853)439851UniRef100_C0Q5T3
424
B5RAL0SYY_SALG2Tyrosine--tRNA ligaseSalmonella gallinarum (strain 287/91 / NCTC 13346)550538UniRef100_C0Q5T3
424
B4THC6SYY_SALHSTyrosine--tRNA ligaseSalmonella heidelberg (strain SL476)454169UniRef100_C0Q5T3
424
B4T586SYY_SALNSTyrosine--tRNA ligaseSalmonella newport (strain SL254)423368UniRef100_C0Q5T3
424
Q5PIK7SYY_SALPATyrosine--tRNA ligaseSalmonella paratyphi A (strain ATCC 9150 / SARB42)295319UniRef100_C0Q5T3
424
A9N034SYY_SALPBTyrosine--tRNA ligaseSalmonella paratyphi B (strain ATCC BAA-1250 / SPB7)1016998UniRef100_C0Q5T3
424
B5BKC0SYY_SALPKTyrosine--tRNA ligaseSalmonella paratyphi A (strain AKU_12601)554290UniRef100_C0Q5T3
424
B4TV08SYY_SALSVTyrosine--tRNA ligaseSalmonella schwarzengrund (strain CVM19633)439843UniRef100_C0Q5T3
424
Q8XG70SYY_SALTITyrosine--tRNA ligaseSalmonella typhi90370UniRef100_C0Q5T3
424
Q7CQK7SYY_SALTYTyrosine--tRNA ligaseSalmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)99287UniRef100_C0Q5T3
424
A7MMK1SYY_CROS8Tyrosine--tRNA ligaseCronobacter sakazakii (strain ATCC BAA-894) (Enterobacter sakazakii)290339UniRef100_A7MMK1
428
A8AH18SYY_CITK8Tyrosine--tRNA ligaseCitrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)290338UniRef100_A8AH18
428
A9MEH2SYY_SALARTyrosine--tRNA ligaseSalmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)41514UniRef100_A9MEH2
428
A1ABI2SYY_ECOK1Tyrosine--tRNA ligaseEscherichia coli O1:K1 / APEC405955UniRef100_A1ABI2
428
Q1RBF8SYY_ECOUTTyrosine--tRNA ligaseEscherichia coli (strain UTI89 / UPEC)364106UniRef100_A1ABI2
428
B7URX8SYY_ECO27Tyrosine--tRNA ligaseEscherichia coli O127:H6 (strain E2348/69 / EPEC)574521UniRef100_A1ABI2
424
B7M9Z1SYY_ECO45Tyrosine--tRNA ligaseEscherichia coli O45:K1 (strain S88 / ExPEC)585035UniRef100_A1ABI2
424
B7L5J0SYY_ECO55Tyrosine--tRNA ligaseEscherichia coli (strain 55989 / EAEC)585055UniRef100_A1ABI2
424
B7MVB5SYY_ECO81Tyrosine--tRNA ligaseEscherichia coli O81 (strain ED1a)585397UniRef100_A1ABI2
424
Q8FH88SYY_ECOL6Tyrosine--tRNA ligaseEscherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)199310UniRef100_A1ABI2
424
A6T9Y5SYY_KLEP7Tyrosine--tRNA ligaseKlebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)272620UniRef100_A6T9Y5
428

Sequence

Representative sequenceiLengthMass (Da)Tools
Q32FD6

Checksumi: 98ECD10D85B47FA2

FASTA42447,539
        10         20         30         40         50
MASSNLIKQL QERGLVAQVT DEEALAERLA QGPIALYCGF DPTADSLHLG
60 70 80 90 100
HLVPLLCLKR FQQAGHKPVA LVGGATGLIG DPSFKAAERK LNTEETVQEW
110 120 130 140 150
VDKIRKQVAP FLDFDCGENS AIAANNYDWF GNMNVLTFLR DIGKHFSVNQ
160 170 180 190 200
MINKEAVKQR LNREDQGISF IEFSYNLLQG YDFACLNKQY GVVLQIGGSD
210 220 230 240 250
QWGNITSGID LTRRLHQNQV FGLTVPLITK ADGTKFGKTE GGAVWLDPKK
260 270 280 290 300
TSPYKFYQFW INTADADVYR FLKFFTFMSI EEINALEEED KNSGKAPRAQ
310 320 330 340 350
YVLAEQVTRL VHGEEGLQAA KRITECLFSG SLSALSEADF EQLAQDGVPM
360 370 380 390 400
VEMEKGADLM QALVDSELQP SRGQARKTIA SNAITINGEK QSDPEYFFKE
410 420
EDRLFGRFTL LRRGKKNYCL ICWK
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again