Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
>UniRef90_Q3LZW9 Envelope small membrane protein n=126 Tax=Coronaviridae TaxID=11118 RepID=VEMP_BCHK3 MYSFVSEETGTLIVNSVLLFLAFVVFLLVTLAILTALRLCAYCCNIVNVSLVKPTVYVYS RVKNLNSSEGVPDLLV

Members

Expand cluster to 50% identity.
List component clusters with 100% identity.
1 to 25 of 126  Show
Cluster membersEntry nameProtein names
Organisms
Organism IDsRelated clustersLength
Role
Q3LZW9VEMP_BCHK3Envelope small membrane proteinBat coronavirus HKU3 (BtCoV) (SARS-like coronavirus HKU3)442736UniRef100_Q3LZW9
76Representative
Q3I5J3VEMP_BCRP3Envelope small membrane proteinBat coronavirus Rp3/2004 (BtCoV/Rp3/2004) (SARS-like coronavirus Rp3)349344UniRef100_Q3LZW9
76
P59637VEMP_CVHSAEnvelope small membrane proteinHuman SARS coronavirus (SARS-CoV) (Severe acute respiratory syndrome coronavirus)694009UniRef100_Q3LZW9
76
Q0Q473VEMP_BC279Envelope small membrane proteinBat coronavirus 279/2005 (BtCoV) (BtCoV/279/2005)389167UniRef100_Q0Q473
76Seed
D3KDM8D3KDM8_CVHSAEnvelope small membrane proteinSARS coronavirus HKU-39849228404UniRef100_Q3LZW9
76
A0A1W5YKU0A0A1W5YKU0_9NIDOEnvelope proteinBat coronavirus1508220UniRef100_Q3LZW9
76
D2E268D2E268_CVHSAEnvelope small membrane proteinSARS coronavirus MA15633137UniRef100_Q3LZW9
76
D2E1D5D2E1D5_CVHSAEnvelope small membrane proteinSARS coronavirus ExoN1627440UniRef100_Q3LZW9
76
D2E1F0D2E1F0_CVHSAEnvelope small membrane proteinSARS coronavirus wtic-MB698419UniRef100_Q3LZW9
76
D2E224D2E224_CVHSAEnvelope small membrane proteinSARS coronavirus MA15 ExoN1633140UniRef100_Q3LZW9
76
A0A2D1PX21A0A2D1PX21_CVHSAEnvelope small membrane proteinBat SARS-like coronavirus1508227UniRef100_Q3LZW9
76
A0A3G5BJ03A0A3G5BJ03_CVHSAEnvelope small membrane proteinSARS coronavirus Urbani228330UniRef100_Q3LZW9
76
J9TE86J9TE86_CVHSAEnvelope small membrane proteinHuman SARS coronavirus (SARS-CoV) (Severe acute respiratory syndrome coronavirus)694009UniRef100_Q3LZW9
76
Q19QW7Q19QW7_CVHSAEnvelope small membrane proteinHuman SARS coronavirus (SARS-CoV) (Severe acute respiratory syndrome coronavirus)694009UniRef100_Q3LZW9
76
B8Q8U0B8Q8U0_CVHSAEnvelope small membrane proteinSARS coronavirus BJ182-4511430UniRef100_Q3LZW9
76
Q6SRL3Q6SRL3_CVHSAEnvelope small membrane proteinSARS coronavirus TW-GD3264380UniRef100_Q3LZW9
76
Q6WGP2Q6WGP2_CVHSAEnvelope small membrane proteinSARS coronavirus ZJ01230471UniRef100_Q3LZW9
76
A0A4Y6GLE3A0A4Y6GLE3_9BETCEnvelope small membrane proteinCoronavirus BtRs-BetaCoV/YN2018D2591237UniRef100_Q3LZW9
76
B8Q8S9B8Q8S9_CVHSAEnvelope small membrane proteinSARS coronavirus BJ182b511433UniRef100_Q3LZW9
76
Q6RD50Q6RD50_CVHSAEnvelope small membrane proteinSARS coronavirus TW11258964UniRef100_Q3LZW9
76
U5WI54U5WI54_CVHSAEnvelope small membrane proteinBat SARS-like coronavirus WIV11415852UniRef100_Q3LZW9
76
Q6SRP9Q6SRP9_CVHSAEnvelope small membrane proteinSARS coronavirus TW-HP1264371UniRef100_Q3LZW9
76
Q3LZV1Q3LZV1_BCHK3Envelope small membrane proteinBat SARS coronavirus HKU3-2338605UniRef100_Q3LZW9
76
Q3ZTF0Q3ZTF0_CVHSAEnvelope small membrane proteinCivet SARS CoV 007/2004285945UniRef100_Q3LZW9
76
Q6RCZ5Q6RCZ5_CVHSAEnvelope small membrane proteinSARS coronavirus TW6258969UniRef100_Q3LZW9
76

Sequence

Representative sequenceiLengthMass (Da)Tools
Q3LZW9

Checksumi: A6D9A31652DDA194

FASTA768,361
        10         20         30         40         50
MYSFVSEETG TLIVNSVLLF LAFVVFLLVT LAILTALRLC AYCCNIVNVS
60 70
LVKPTVYVYS RVKNLNSSEG VPDLLV
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again