Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
>UniRef90_Q4ACU6-6 Isoform 5 of SH3 and multiple ankyrin repeat domains protein 3 n=3 Tax=Murinae TaxID=39107 RepID=Isoform 6 of SHAN3_MOUSE MEAPGAGFACPLPPGIASVTYVFVYSPSGPGGSGPAPGPGPASPAPPAPPPRGPKRKLYS AVPGRKFIAVKAHSPQGEGEIPLHRGEAVKVLSIGEGGFWEGTVKGRTGWFPADCVEEVQ MRQYDTRHETREDRTKRLFRHYTVGSYDSLTSHSDYVIDDKVAILQKRDHEGFGFVLRGA KAETPIEEFTPTPAFPALQYLESVDVEGVAWRAGLRTGDFLIEVNGVNVVKVGHKQVVGL IRQGGNRLVMKVVSVTRKPEEDGARRRAPPPPKRAPSTTLTLRSKSMTAELEELASIRRR KGEKLDEILAVAAEPTLRPDIADADSRAATVKQRPTSRRITPAEISSLFERQGLPGPEKL PGSLRKGIPRTKSVGSSAASVS

Members

Expand cluster to 50% identity.
List component clusters with 100% identity.
1 to 3 of 3  Show
Cluster membersEntry nameProtein names
Organisms
Organism IDsRelated clustersLength
Role
Q4ACU6-6Isoform 6 of SHAN3_MOUSE5, C4Mus musculus (Mouse)10090UniRef100_Q4ACU6-6
382Representative
A0A0U1RRP4A0A0U1RRP4_RATSH3 and multiple ankyrin repeat domains protein 3Rattus norvegicus (Rat)10116UniRef100_A0A0U1RRP4
382Seed
A0A2R8VH81A0A2R8VH81_MOUSESH3 and multiple ankyrin repeat domains protein 3Mus musculus (Mouse)10090UniRef100_A0A2R8VH81
307

Sequence

Representative sequenceiLengthMass (Da)Tools
Q4ACU6-6

Checksumi: 27B9B22AB57A32EE

FASTA38241,168
        10         20         30         40         50
MEAPGAGFAC PLPPGIASVT YVFVYSPSGP GGSGPAPGPG PASPAPPAPP
60 70 80 90 100
PRGPKRKLYS AVPGRKFIAV KAHSPQGEGE IPLHRGEAVK VLSIGEGGFW
110 120 130 140 150
EGTVKGRTGW FPADCVEEVQ MRQYDTRHET REDRTKRLFR HYTVGSYDSL
160 170 180 190 200
TSHSDYVIDD KVAILQKRDH EGFGFVLRGA KAETPIEEFT PTPAFPALQY
210 220 230 240 250
LESVDVEGVA WRAGLRTGDF LIEVNGVNVV KVGHKQVVGL IRQGGNRLVM
260 270 280 290 300
KVVSVTRKPE EDGARRRAPP PPKRAPSTTL TLRSKSMTAE LEELASIRRR
310 320 330 340 350
KGEKLDEILA VAAEPTLRPD IADADSRAAT VKQRPTSRRI TPAEISSLFE
360 370 380
RQGLPGPEKL PGSLRKGIPR TKSVGSSAAS VS
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again