Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
>UniRef90_Q4URE1 50S ribosomal protein L23 n=127 Tax=Proteobacteria TaxID=1224 RepID=RL23_XANC8 MSSNEKIFSVLRAPRVSEKTARLQEISNQYVFEVSNEATKADVKAAVEQLFDVKVKAVNV VNVKGKSKSFRNRAGSRGNWRKAYVRLVDGQSIDVTAKA

Members

Expand cluster to 50% identity.
List component clusters with 100% identity.
1 to 25 of 127  Show
Cluster membersEntry nameProtein names
Organisms
Organism IDsRelated clustersLength
Role
Q4URE1RL23_XANC850S ribosomal protein L23Xanthomonas campestris pv. campestris (strain 8004)314565UniRef100_Q4URE1
99Representative
B0RU80RL23_XANCB50S ribosomal protein L23Xanthomonas campestris pv. campestris (strain B100)509169UniRef100_Q4URE1
99
Q8PC47RL23_XANCP50S ribosomal protein L23Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)190485UniRef100_Q4URE1
99
Q8PNS2RL23_XANAC50S ribosomal protein L23Xanthomonas axonopodis pv. citri (strain 306)190486UniRef100_Q8PNS2
99
Q3BWY1RL23_XANC550S ribosomal protein L23Xanthomonas campestris pv. vesicatoria (strain 85-10)316273UniRef100_Q8PNS2
99
Q2NZY7RL23_XANOM50S ribosomal protein L23Xanthomonas oryzae pv. oryzae (strain MAFF 311018)342109UniRef100_Q8PNS2
99
B2SQR2RL23_XANOP50S ribosomal protein L23Xanthomonas oryzae pv. oryzae (strain PXO99A)360094UniRef100_Q8PNS2
99
Q5GWT6RL23_XANOR50S ribosomal protein L23Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85)291331UniRef100_Q8PNS2
99
A0A517GKX8A0A517GKX8_XANCG50S ribosomal protein L23Xanthomonas campestris pv. glycines473421UniRef100_Q4URE1
99
A0A4Q6ETZ2A0A4Q6ETZ2_9PROT50S ribosomal protein L23Proteobacteria bacterium1977087UniRef100_Q4URE1
99
A0A4U0TI81A0A4U0TI81_XANEU50S ribosomal protein L23Xanthomonas euvesicatoria pv. citrumelonis189396UniRef100_Q4URE1
99
A0A0A3GK41A0A0A3GK41_XANVA50S ribosomal protein L23Xanthomonas vasicola56459UniRef100_Q4URE1
99
A0A2S6YBJ0A0A2S6YBJ0_9XANT50S ribosomal protein L23Xanthomonas arboricola56448UniRef100_Q4URE1
99
A0A2S6Z337A0A2S6Z337_9XANT50S ribosomal protein L23Xanthomonas arboricola pv. populi487823UniRef100_Q4URE1
99
A0A2N7V782A0A2N7V782_XANCJ50S ribosomal protein L23Xanthomonas campestris pv. juglandis (Xanthomonas arboricola pv. juglandis)195709UniRef100_Q4URE1
99
A0A0D0KN93A0A0D0KN93_XANCA50S ribosomal protein L23Xanthomonas campestris339UniRef100_Q4URE1
99
A0A315F406A0A315F406_XANVA50S ribosomal protein L23Xanthomonas vasicola pv. vasculorum325776UniRef100_Q4URE1
99
W4SNN7W4SNN7_9XANT50S ribosomal protein L23Xanthomonas arboricola pv. pruni MAFF 3014201418095UniRef100_Q4URE1
99
A0A3R9XXR5A0A3R9XXR5_9XANT50S ribosomal protein L23Xanthomonas arboricola pv. pruni69929UniRef100_Q4URE1
99
A0A0G8YFL3A0A0G8YFL3_9XANT50S ribosomal protein L23Xanthomonas perforans442694UniRef100_Q4URE1
99
A0A2S7D8P4A0A2S7D8P4_9XANT50S ribosomal protein L23Xanthomonas pisi56457UniRef100_Q4URE1
99
A0A2S7BYM8A0A2S7BYM8_9XANT50S ribosomal protein L23Xanthomonas dyei743699UniRef100_Q4URE1
99
W4S4H3W4S4H3_9XANT50S ribosomal protein L23Xanthomonas arboricola pv. pruni str. MAFF 3115621414836UniRef100_Q4URE1
99
A0A3S9RLA1A0A3S9RLA1_XANCA50S ribosomal protein L23Xanthomonas campestris pv. arecae487849UniRef100_Q4URE1
99
A0A3E1KMD0A0A3E1KMD0_9XANT50S ribosomal protein L23Xanthomonas nasturtii1843581UniRef100_Q4URE1
99

Sequence

Representative sequenceiLengthMass (Da)Tools
Q4URE1

Checksumi: F12A629DE2E36097

FASTA9911,017
        10         20         30         40         50
MSSNEKIFSV LRAPRVSEKT ARLQEISNQY VFEVSNEATK ADVKAAVEQL
60 70 80 90
FDVKVKAVNV VNVKGKSKSF RNRAGSRGNW RKAYVRLVDG QSIDVTAKA
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again