Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
>UniRef90_Q5ZKT8 39S ribosomal protein L15, mitochondrial n=11 Tax=Neognathae TaxID=8825 RepID=RM15_CHICK MSGNGVHGVHGALQLLRSLPKVSLANLRPNPGSKKPERRRGRGRYRGRKCGRGHKGERQR GNRPRLGFEGGQTPFYLSIPKYGFNEGHSCRRKYHPLSLQKLQYLIDLGRVDPTQPIDLT QLTNARGVTVQPLKRDYGVQLVEEGADIFAAKINIEVQRASELAIAAIEKNGGVVTASFY DPRSLEILIRPVPFFLRGQPIPKRMLPPEDLVRYYTDASNRGYLADPSKVAEARLELAKK YGYTLPDITKDELFKMLSTRKDPRQIFFGLAPGWIVNMADKKILKPTDERLLKYYSS

Members

Expand cluster to 50% identity.
List component clusters with 100% identity.
1 to 11 of 11  Show
Cluster membersEntry nameProtein names
Organisms
Organism IDsRelated clustersLength
Role
Q5ZKT8RM15_CHICK39S ribosomal protein L15, mitochondrialGallus gallus (Chicken)9031UniRef100_Q5ZKT8
297Representative
G1NEM9G1NEM9_MELGARibosomal_L18e/L15P domain-containing proteinMeleagris gallopavo (Wild turkey)9103UniRef100_G1NEM9
298Seed
A0A1D5PBN7A0A1D5PBN7_CHICK39S ribosomal protein L15, mitochondrialGallus gallus (Chicken)9031UniRef100_A0A1D5PBN7
297
A0A091QI61A0A091QI61_MERNURibosomal_L18e/L15P domain-containing protein (Fragment)Merops nubicus (Northern carmine bee-eater)57421UniRef100_A0A091QI61
296
UPI000203546639S ribosomal protein L15, mitochondrialMeleagris gallopavo (Wild turkey)9103UniRef100_G1NEM9
294
UPI0004F02C8239S ribosomal protein L15, mitochondrial isoform X1Merops nubicus (Northern carmine bee-eater)57421UniRef100_A0A091QI61
294
UPI00052861DF39S ribosomal protein L15, mitochondrialEurypyga helias (Sunbittern)54383UniRef100_UPI00052861DF
294
UPI000B3E02AF39S ribosomal protein L15, mitochondrialNumida meleagris (Helmeted guineafowl) (Phasianus meleagris)8996UniRef100_UPI000B3E02AF
294
UPI00077704E739S ribosomal protein L15, mitochondrialCoturnix japonica (Japanese quail) (Coturnix coturnix japonica)93934UniRef100_UPI00077704E7
294
UPI0004F0431A39S ribosomal protein L15, mitochondrial isoform X2Merops nubicus (Northern carmine bee-eater)57421UniRef100_UPI0004F0431A
293
UPI000528409139S ribosomal protein L15, mitochondrialPterocles gutturalis (yellow-throated sandgrouse)240206UniRef100_UPI0005284091
277

Sequence

Representative sequenceiLengthMass (Da)Tools
Q5ZKT8

Checksumi: 5EDD0BA24A2DB026

FASTA29733,557
        10         20         30         40         50
MSGNGVHGVH GALQLLRSLP KVSLANLRPN PGSKKPERRR GRGRYRGRKC
60 70 80 90 100
GRGHKGERQR GNRPRLGFEG GQTPFYLSIP KYGFNEGHSC RRKYHPLSLQ
110 120 130 140 150
KLQYLIDLGR VDPTQPIDLT QLTNARGVTV QPLKRDYGVQ LVEEGADIFA
160 170 180 190 200
AKINIEVQRA SELAIAAIEK NGGVVTASFY DPRSLEILIR PVPFFLRGQP
210 220 230 240 250
IPKRMLPPED LVRYYTDASN RGYLADPSKV AEARLELAKK YGYTLPDITK
260 270 280 290
DELFKMLSTR KDPRQIFFGL APGWIVNMAD KKILKPTDER LLKYYSS
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again