Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
>UniRef90_Q6UWP2 Dehydrogenase/reductase SDR family member 11 n=53 Tax=Boreoeutheria TaxID=1437010 RepID=DHR11_HUMAN MARPGMERWRDRLALVTGASGGIGAAVARALVQQGLKVVGCARTVGNIEELAAECKSAGY PGTLIPYRCDLSNEEDILSMFSAIRSQHSGVDICINNAGLARPDTLLSGSTSGWKDMFNV NVLALSICTREAYQSMKERNVDDGHIININSMSGHRVLPLSVTHFYSATKYAVTALTEGL RQELREAQTHIRATCISPGVVETQFAFKLHDKDPEKAAATYEQMKCLKPEDVAEAVIYVL STPAHIQIGDIQMRPTEQVT

Members

Expand cluster to 50% identity.
List component clusters with 100% identity.
1 to 25 of 53  Show
Cluster membersEntry nameProtein names
Organisms
Organism IDsRelated clustersLength
Role
Q6UWP2DHR11_HUMANDehydrogenase/reductase SDR family member 11Homo sapiens (Human)9606UniRef100_Q6UWP2
260Representative
A0A024R0T1A0A024R0T1_HUMANShort-chain dehydrogenase/reductase, isoform CRA_bHomo sapiens (Human)9606UniRef100_Q6UWP2
260
G3QY64G3QY64_GORGODehydrogenase/reductase 11Gorilla gorilla gorilla (Western lowland gorilla)9595UniRef100_Q6UWP2
260
Q6UWP2-2Isoform 2 of DHR11_HUMAN2Homo sapiens (Human)9606UniRef100_Q6UWP2
181
A0A1D5Q6X5A0A1D5Q6X5_MACMUUncharacterized proteinMacaca mulatta (Rhesus macaque)9544UniRef100_A0A1D5Q6X5
297
F6Y1E5F6Y1E5_MACMUDehydrogenase/reductase SDR family member 11Macaca mulatta (Rhesus macaque)9544UniRef100_F6Y1E5
260
A0A2K5JBN2A0A2K5JBN2_COLAPDehydrogenase/reductase 11Colobus angolensis palliatus (Peters' Angolan colobus)336983UniRef100_F6Y1E5
244
G7PUI9G7PUI9_MACFADehydrogenase/reductase SDR family member 11 (Fragment)Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)9541UniRef100_F6Y1E5
211
A0A2K5KI15A0A2K5KI15_CERATDehydrogenase/reductase 11Cercocebus atys (Sooty mangabey) (Cercocebus torquatus atys)9531UniRef100_F6Y1E5
260
A0A096P512A0A096P512_PAPANDehydrogenase/reductase 11Papio anubis (Olive baboon)9555UniRef100_F6Y1E5
260
A0A0D9R161A0A0D9R161_CHLSBDehydrogenase/reductase 11Chlorocebus sabaeus (Green monkey) (Cercopithecus sabaeus)60711UniRef100_F6Y1E5
260
A0A2K5XYH3A0A2K5XYH3_MANLEDehydrogenase/reductase 11Mandrillus leucophaeus (Drill) (Papio leucophaeus)9568UniRef100_F6Y1E5
260
A0A2K5TMP0A0A2K5TMP0_MACFADehydrogenase/reductase 11Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)9541UniRef100_F6Y1E5
260
G7NI07G7NI07_MACMUDehydrogenase/reductase SDR family member 11 (Fragment)Macaca mulatta (Rhesus macaque)9544UniRef100_F6Y1E5
235
A0A087WZN3A0A087WZN3_HUMANDehydrogenase/reductase SDR family member 11 (Fragment)Homo sapiens (Human)9606UniRef100_F6Y1E5
150
G1TTJ1G1TTJ1_RABITDehydrogenase/reductase 11Oryctolagus cuniculus (Rabbit)9986UniRef100_G1TTJ1
260
G3V978G3V978_RATDehydrogenase/reductase 11Rattus norvegicus (Rat)10116UniRef100_G3V978
260
Q5M7U4Q5M7U4_RATUncharacterized proteinRattus norvegicus (Rat)10116UniRef100_G3V978
181
H2NTG0H2NTG0_PONABDHRS11 isoform 1Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii)9601UniRef100_H2NTG0
260
A0A2J8RCH7A0A2J8RCH7_PONABDHRS11 isoform 2Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii)9601UniRef100_H2NTG0
181
A0A2J8RCJ0A0A2J8RCJ0_PONABDHRS11 isoform 6 (Fragment)Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii)9601UniRef100_H2NTG0
150
A0A2Z6DUF7A0A2Z6DUF7_RABITDehydrogenase/reductase SDR family member 11Oryctolagus cuniculus (Rabbit)9986UniRef100_A0A2Z6DUF7
260
A0A2K6QGK6A0A2K6QGK6_RHIRODehydrogenase/reductase 11Rhinopithecus roxellana (Golden snub-nosed monkey) (Pygathrix roxellana)61622UniRef100_A0A2K6QGK6
260
G1QP81G1QP81_NOMLEDehydrogenase/reductase 11Nomascus leucogenys (Northern white-cheeked gibbon) (Hylobates leucogenys)61853UniRef100_G1QP81
260
L5MBZ1L5MBZ1_MYODSDehydrogenase/reductase SDR family member 11Myotis davidii (David's myotis)225400UniRef100_L5MBZ1
255

Sequence

Representative sequenceiLengthMass (Da)Tools
Q6UWP2

Checksumi: 88DFF656874F19F4

FASTA26028,308
        10         20         30         40         50
MARPGMERWR DRLALVTGAS GGIGAAVARA LVQQGLKVVG CARTVGNIEE
60 70 80 90 100
LAAECKSAGY PGTLIPYRCD LSNEEDILSM FSAIRSQHSG VDICINNAGL
110 120 130 140 150
ARPDTLLSGS TSGWKDMFNV NVLALSICTR EAYQSMKERN VDDGHIININ
160 170 180 190 200
SMSGHRVLPL SVTHFYSATK YAVTALTEGL RQELREAQTH IRATCISPGV
210 220 230 240 250
VETQFAFKLH DKDPEKAAAT YEQMKCLKPE DVAEAVIYVL STPAHIQIGD
260
IQMRPTEQVT
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again