Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
>UniRef90_Q6UX46-2 Isoform 2 of ALK and LTK ligand 2 n=4 Tax=Catarrhini TaxID=9526 RepID=Isoform 2 of ALKL2_HUMAN MRGPGHPLLLGLLLVLGPSPEQRVEIVPRDLRMKDKFLKHLTGPLYFSPKCSKHFHRLYH NTRDCTIPAYYKRCARLLTRLAVSPVCMEDK

Members

Expand cluster to 50% identity.
List component clusters with 100% identity.
1 to 4 of 4  Show
Cluster membersEntry nameProtein names
Organisms
Organism IDsRelated clustersLength
Role
Q6UX46-2Isoform 2 of ALKL2_HUMAN2Homo sapiens (Human)9606UniRef100_Q6UX46-2
91Representative
F7HJ23F7HJ23_MACMUUncharacterized proteinMacaca mulatta (Rhesus macaque)9544UniRef100_F7HJ23
111Seed
A0A2J8SHD6A0A2J8SHD6_PONABALKAL2 isoform 3Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii)9601UniRef100_A0A2J8SHD6
91
A0A2J8J639A0A2J8J639_PANTRALKAL2 isoform 3Pan troglodytes (Chimpanzee)9598UniRef100_A0A2J8SHD6
91

Sequence

Representative sequenceiLengthMass (Da)Tools
Q6UX46-2

Checksumi: 0EE995ED103A46C4

FASTA9110,542
        10         20         30         40         50
MRGPGHPLLL GLLLVLGPSP EQRVEIVPRD LRMKDKFLKH LTGPLYFSPK
60 70 80 90
CSKHFHRLYH NTRDCTIPAY YKRCARLLTR LAVSPVCMED K
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again