Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
>UniRef90_Q7N078 50S ribosomal protein L13 n=841 RepID=RL13_PHOLL MKTFTAKPETVKRDWYVVDADGKTLGRLATEVARRLRGKHKAEYTPHVDTGDYIIIVNAE KVAVTGNKRSDKIYYHHTGHIGGIKQATFEEMIARRPERVIEIAVKGMLPKGPLGRAMYR KLKVYAGSEHNHAAQQPQVLDI

Members

Expand cluster to 50% identity.
List component clusters with 100% identity.
1 to 25 of 841  Show
Cluster membersEntry nameProtein names
Organisms
Organism IDsRelated clustersLength
Role
Q7N078RL13_PHOLL50S ribosomal protein L13Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)243265UniRef100_Q7N078
142Representative
B4EXL9RL13_PROMH50S ribosomal protein L13Proteus mirabilis (strain HI4320)529507UniRef100_B4EXL9
142
Q6DAE7RL13_PECAS50S ribosomal protein L13Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) (Erwinia carotovora subsp. atroseptica)218491UniRef100_Q6DAE7
142
B2U1V4RL13_SHIB350S ribosomal protein L13Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)344609UniRef100_B2U1V4
142
Q31W99RL13_SHIBS50S ribosomal protein L13Shigella boydii serotype 4 (strain Sb227)300268UniRef100_B2U1V4
142
B2VGX3RL13_ERWT950S ribosomal protein L13Erwinia tasmaniensis (strain DSM 17950 / CIP 109463 / Et1/99)465817UniRef100_B2VGX3
142
A7FDX4RL13_YERP350S ribosomal protein L13Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)349747UniRef100_A7FDX4
142
Q1C1H0RL13_YERPA50S ribosomal protein L13Yersinia pestis bv. Antiqua (strain Antiqua)360102UniRef100_A7FDX4
142
B2K3Z7RL13_YERPB50S ribosomal protein L13Yersinia pseudotuberculosis serotype IB (strain PB1/+)502801UniRef100_A7FDX4
142
Q0WB88RL13_YERPE50S ribosomal protein L13Yersinia pestis632UniRef100_A7FDX4
142
A9R1S0RL13_YERPG50S ribosomal protein L13Yersinia pestis bv. Antiqua (strain Angola)349746UniRef100_A7FDX4
142
Q1CE08RL13_YERPN50S ribosomal protein L13Yersinia pestis bv. Antiqua (strain Nepal516)377628UniRef100_A7FDX4
142
A4THJ1RL13_YERPP50S ribosomal protein L13Yersinia pestis (strain Pestoides F)386656UniRef100_A7FDX4
142
Q665K9RL13_YERPS50S ribosomal protein L13Yersinia pseudotuberculosis serotype I (strain IP32953)273123UniRef100_A7FDX4
142
B1JL66RL13_YERPY50S ribosomal protein L13Yersinia pseudotuberculosis serotype O:3 (strain YPIII)502800UniRef100_A7FDX4
142
C6DIQ1RL13_PECCP50S ribosomal protein L13Pectobacterium carotovorum subsp. carotovorum (strain PC1)561230UniRef100_C6DIQ1
142
Q2NWI4RL13_SODGM50S ribosomal protein L13Sodalis glossinidius (strain morsitans)343509UniRef100_Q2NWI4
142
A8GK03RL13_SERP550S ribosomal protein L13Serratia proteamaculans (strain 568)399741UniRef100_A8GK03
142
A1JR94RL13_YERE850S ribosomal protein L13Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)393305UniRef100_A1JR94
142
B5XSS1RL13_KLEP350S ribosomal protein L13Klebsiella pneumoniae (strain 342)507522UniRef100_B5XSS1
142
A6TEN9RL13_KLEP750S ribosomal protein L13Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)272620UniRef100_B5XSS1
142
C5B747RL13_EDWI950S ribosomal protein L13Edwardsiella ictaluri (strain 93-146)634503UniRef100_C5B747
142
A7MJB9RL13_CROS850S ribosomal protein L13Cronobacter sakazakii (strain ATCC BAA-894) (Enterobacter sakazakii)290339UniRef100_A7MJB9
142
A8AQC1RL13_CITK850S ribosomal protein L13Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)290338UniRef100_A8AQC1
142
A0A0A0CRL6A0A0A0CRL6_PHOLU50S ribosomal protein L13Photorhabdus luminescens (Xenorhabdus luminescens)29488UniRef100_Q7N078
142

Sequence

Representative sequenceiLengthMass (Da)Tools
Q7N078

Checksumi: 54CB08FCD5C11E38

FASTA14216,022
        10         20         30         40         50
MKTFTAKPET VKRDWYVVDA DGKTLGRLAT EVARRLRGKH KAEYTPHVDT
60 70 80 90 100
GDYIIIVNAE KVAVTGNKRS DKIYYHHTGH IGGIKQATFE EMIARRPERV
110 120 130 140
IEIAVKGMLP KGPLGRAMYR KLKVYAGSEH NHAAQQPQVL DI
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again